KEGG   Burkholderia contaminans: NL30_00985Help
Entry
NL30_00985        CDS       T03969                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00380  Tryptophan metabolism
bcon00630  Glyoxylate and dicarboxylate metabolism
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon01130  Biosynthesis of antibiotics
bcon01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NL30_00985
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    NL30_00985
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NL30_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AKM38577
LinkDB All DBs
Position
1:complement(242821..244290)
Genome map
AA seq 489 aa AA seqDB search
MTNRDTSTGLAHATGAPVVDNLNIETAGPRGPALLQDIWLIEKLAHFDREVIPERRMHAK
GSGAHGVFTVTHDITRYTKAKLFSEIGKTTPVFLRFSTVAGERGAADAERDIRGFAVKFY
TEEGNWDIVGNNTPVFFFRDPLRFPDLNHAIKRDPRTGLRNANSNWDFWSLLPEALHQVT
IVMSDRGIPRSYRHMHGFGSHTFSFVDAENRRTWVKFHLRTQQGIANLTDAEAESLVGKD
RETHGRDLFESIERGEFPRWTLHVQVMNDEQAKSLPFNPFDLTKVWPKGDFPLIEVGVLE
LNRNPDNYFAEVEQAAFSPANVVPGIGFSPDKMLQARLFSYGDTQRYRLGVNFNHIPVNA
PKCPFHSYHRDGAMRTDGNLGATPSYYPNSLHEWEVRPGLHEPALRIEGDAAHWDHRVDE
DHFAQPGNLFRLMSKEQQQVLFDNTARQIVGVHAPIQDRHIANCAKADPEYGAGIREALA
KLAGSAATR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgcgatacgtctacgggtcttgctcacgcaacgggtgcgcccgttgtcgac
aatctgaacatcgaaacggccggcccgcgtggtccggcgctcttgcaggacatctggctg
atcgagaaactcgcgcatttcgaccgggaagtgatccccgagcggcgcatgcacgcaaaa
ggatcgggcgcgcacggcgtgttcacggttacgcatgacatcacgcgctacacgaaagca
aagttgttttccgagatcggcaagacgacgccggtattcctgcggttctcgaccgtggcc
ggcgagcgcggcgccgcggacgccgaacgcgacattcgcggcttcgcggtgaagttctac
acggaagaaggaaactgggacatcgtgggcaacaacacgcctgtatttttcttccgcgac
ccgttgcgctttcccgatctgaaccacgcgatcaagcgcgacccgcgtacgggattgcgc
aacgccaacagcaactgggacttttggtcgctgctgccggaggcgctgcaccaggtcacg
atcgtcatgagcgatcgaggcattccgcgcagctatcgccacatgcacggctttggcagc
cacacattcagctttgtcgatgcggagaatcggcgtacgtgggtaaagtttcacttgcgc
acccagcaaggcatcgcgaacctgaccgacgccgaagccgaaagcctcgtggggaaggac
cgtgagacgcatggccgcgatctcttcgagagcatcgagcgcggcgagtttccccgctgg
acgctccatgtccaggtgatgaacgacgagcaggcaaagtcgctgccattcaacccgttc
gatctcaccaaggtctggccaaagggcgactttccactgatcgaggtcggcgttctcgaa
ctgaaccgcaaccccgacaactacttcgccgaagtcgagcaggctgcgttctcgccggcg
aacgtggtgcccgggatcggcttctcgcccgacaagatgcttcaggctcgcctgttctcc
tatggcgatacgcaacggtacaggctcggcgtgaacttcaatcacatcccggtcaacgcg
ccgaagtgcccgtttcacagctatcaccgcgacggcgcgatgcgcaccgacggcaacctc
ggcgccacgccgtcctattacccgaacagtctccacgagtgggaggttcggcccggcctg
catgagccggcgctgcgaatcgaaggcgacgccgcgcattgggatcaccgcgtggacgaa
gatcacttcgcgcaacccggcaatctgttccgtctgatgagcaaggaacaacagcaggtg
ctgttcgacaacaccgcacgccagatcgtcggtgtccacgcacctatccaggaccgccat
attgccaactgtgcgaaagcggacccggaatatggcgcgggcattcgcgaagccctggcg
aagctcgccggatcggcagccacacgctag

DBGET integrated database retrieval system