KEGG   Burkholderia contaminans: NL30_06345
Entry
NL30_06345        CDS       T03969                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00020  Citrate cycle (TCA cycle)
bcon00620  Pyruvate metabolism
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon01120  Microbial metabolism in diverse environments
bcon01200  Carbon metabolism
Module
bcon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NL30_06345
   00620 Pyruvate metabolism
    NL30_06345
   00650 Butanoate metabolism
    NL30_06345
Enzymes [BR:bcon01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     NL30_06345
SSDB
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Other DBs
NCBI-ProteinID: AKM39542
UniProt: A0A0G3YQ39
LinkDB
Position
1:complement(1470240..1471754)
AA seq 504 aa
MSSSRILAPALRSLVRTADEAAALIRPGMTVAMSGFTGSGYPKAVPAALAAHIDAAHTRG
EDFRINVLTGASTAPELDGALARTNGISMRLPYQSDPTLRDKINGGEVDYQDVHLSHVAQ
YAWFGLYGDLDVAIVEVAGIREDGLLIPSASIGNNKTWLERAKHVILEVNSRQPLGLDGM
HDVYYGTALPPHRKPIPLTKSDDRIGEPYLRCPADKIVAIVETDAPDRSNAFSAPDATSK
QIAHQLIDFLRHEVKRGRLPENLLPLQSGVGNITNAVLAELSSAGFSNLTAYTEVIQDGM
LDLLQDGTLSFASATALSLSPAAVQRFADEIATFREKIVLRPQEISNHPELVRRLGCIAM
NGMIEADIYGNVNSTHVMGTKIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMAS
HVDHTEHDVAVVVTEQGLADLRGLSPKQRARKIIATCAHPDYRPMLEDYFERASRESFGK
HTPHLLAEALSWHERYVRTGTMKA
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtcttcatcacgcatcctcgcccccgccctgcgttcgctcgtccgcaccgccgacgaa
gccgccgcgctgatccgccccggcatgaccgtcgccatgagcggcttcacgggctccggc
tatccgaaagccgtaccggccgcacttgccgcccacatcgacgcggcgcacacgcgcggc
gaggacttccggatcaacgtactgacgggcgcatcgaccgcgccggaactcgacggcgcg
ctcgcgcgcaccaacggcatctcgatgcgcctgccgtaccagtccgacccgacgttgcgc
gacaagatcaacggcggcgaagtcgactaccaggacgtccacctgagccacgtcgcgcag
tacgcatggttcgggctgtacggcgatctcgatgtcgcgatcgtcgaagtcgcgggcatc
cgcgaggacggcctgctgattccgtccgcgtcgatcggcaacaacaagacctggctcgaa
cgcgcgaagcacgtgatcctcgaggtcaactcgcgccagccgctcggcctcgacgggatg
cacgacgtctattacggcaccgcgctgccgccgcaccgcaagccgattccgctgacgaag
agcgacgaccggatcggcgagccgtacctgcgctgcccggccgacaagatcgtcgcgatc
gtcgagaccgacgcgccggatcgcagcaacgcgttctcagcgccggacgcgacgtcgaag
cagatcgcgcatcaactgatcgacttcctgcgtcacgaagtgaagcgcgggcgcctgccg
gaaaacctgctgccgctgcagtcgggtgtcggcaacatcacgaacgcggtgctcgcggag
ctcagctcggctggcttctcgaacctgaccgcgtacaccgaggtgatccaggacggcatg
ctcgacctgctgcaggacggcacgttgagcttcgcgtcggccaccgcgctgtcgctgagc
ccggccgccgtgcagcgctttgccgacgaaatcgcgacgttccgcgagaagatcgtgctg
cgcccgcaggagatcagcaaccatccggaactcgtgcgtcgcctcggctgcatcgcgatg
aacgggatgatcgaggccgacatctacggcaacgtgaactcgacgcacgtgatgggcacg
aagatccagaacggcatcggcggctcgggcgacttcgcgcgcaacggctacctgtcgtgc
ttcatgtcggcgagtaccgccaagggcggcgcgatctcgcggatcgtgccgatggcgagc
cacgtcgaccataccgagcacgacgtcgcggtggtcgtcaccgagcagggcctcgcggac
ctgcgcggcctgtcgccgaagcagcgcgcacgcaagatcatcgcgacctgcgcgcacccc
gattaccggccgatgctcgaggattacttcgagcgcgcgtcgcgcgaaagcttcggcaaa
catacgccgcatctgctcgccgaggcgctgtcgtggcacgagcgctacgtgcgcaccggc
acgatgaaggcctga

DBGET integrated database retrieval system