KEGG   Burkholderia contaminans: NL30_06525Help
Entry
NL30_06525        CDS       T03969                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcon  Burkholderia contaminans
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NL30_06525
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NL30_06525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like DAO K_oxygenase FAD_oxidored Glutaredoxin Thi4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AKM39577
UniProt: A0A0G3YQB1
LinkDB All DBs
Position
1:1516181..1517779
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLTEIASLTDRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQGEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGDTQRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAPVAAAQPQAEEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
accgagattgcgtcgctgacggatcgcgtgaccgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggccggcattcgcttcgccggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactacgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgttgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
ggtgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcgtcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccagc
gcgcgtgccgcgaagtcgctcgagaacaagccggtgttcgatacgctgatcgtcggcggc
ggcccggcaggcgctgcagctgcgatctactcggcgcgcaagggcattgcaaccggcgtc
gtcgccgagcgcttcggcggccaggtgctcgatacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgcgaccgcgctcgaacagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgatgcgctgatcccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcgtcctcgcaaccggcgcg
cgctggcgtgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggcatcgtgaaggccgtcacgctgatc
gaatacggcgcgcaactgcgtgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcaaacgacggagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgctcgggcgacacgcagcgcatcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgagtggctgaaggggacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtaccgggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgccgtgggcgaaggc
gcgaaggcatcgctcggcgcgttcgaccacctgatccggcaggacgtcgcaccggttgcc
gccgcacagccgcaggccgaggaagcggtcgccgcgtaa

DBGET integrated database retrieval system