KEGG   Burkholderia contaminans: NL30_06910
Entry
NL30_06910        CDS       T03969                                 

Definition
(GenBank) Asp/Glu racemase
  KO
K01799  maleate isomerase [EC:5.2.1.1]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00650  Butanoate metabolism
bcon00760  Nicotinate and nicotinamide metabolism
bcon01100  Metabolic pathways
bcon01120  Microbial metabolism in diverse environments
Module
bcon_M00622  Nicotinate degradation, nicotinate => fumarate
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_06910
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NL30_06910
Enzymes [BR:bcon01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.1  maleate isomerase
     NL30_06910
SSDB
Motif
Pfam: Amdase
Other DBs
NCBI-ProteinID: AKM39642
UniProt: A0A6P2YN47
LinkDB
Position
1:1612487..1613239
AA seq 250 aa
MSKTYRIGQIVPSSNTTMETEIPAMLRLRETIRPERFTYHSSRMRMKKVVKEELAAMDAE
SDRCAVELSDARVDVLGYACLVAIMAMGHGYHRVSQARLTKHTADNGAQAPVLTSAGALV
DALKVIGAKRIVVVAPYMLPLTELVVDYIRNEGFDVLAYRALEIPDNLDVGRHDPARLPD
IVKTLPYQDADAIVLSACVQMPSLPAVAKVEAITGKPVITAAIATTYAMLRELDLEPIVP
GAGALLSGAY
NT seq 753 nt   +upstreamnt  +downstreamnt
atgagcaagacctaccgcatcggccagatcgtgccgagttccaacacgacgatggaaacc
gagattcccgcgatgctgcggctgcgcgaaacgatccgccccgagcgcttcacgtaccac
tcgagccggatgcggatgaagaaggtcgtcaaggaggaactcgcggcaatggatgccgaa
tccgaccgctgcgcagtggaactgagcgatgcacgcgtcgacgtgctcggctacgcgtgc
ctcgtcgcgatcatggcgatggggcacggctaccaccgtgtgtcgcaggcacgcctgacg
aagcacacggcggacaacggcgcgcaggcgcccgtgctgacgagtgcgggcgcgctcgtc
gacgcactgaaggtgatcggcgcgaagcggatcgtcgtcgtcgcgccgtacatgctgccg
ctgaccgaactcgtggtcgactacatccgcaacgaaggcttcgacgtgctcgcgtaccgc
gcgctggagatccccgacaacctcgacgtcggccgccacgatccggcgcgcctgcccgac
atcgtgaagacgctgccttaccaggacgccgatgcgatcgtgctgtccgcctgcgtgcag
atgccgtcgctgccggccgtcgcgaaggtcgaggcgatcacgggcaagcccgtgatcacg
gccgcgatcgcgacgacctacgcaatgctgcgcgagctcgacctcgagccgatcgtgccc
ggcgccggcgcgctgctgtccggcgcgtactga

DBGET integrated database retrieval system