KEGG   Burkholderia contaminans: NL30_07955Help
Entry
NL30_07955        CDS       T03969                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NL30_07955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcon02000]
    NL30_07955
Enzymes [BR:bcon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NL30_07955
Transporters [BR:bcon02000]
 Other Transporters
  Pores ion channels [TC:1]
   NL30_07955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKM39840
UniProt: A0A0G3YQV2
LinkDB All DBs
Position
1:1849512..1850180
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELDVPYEIVRYARDPKTMLAPPALRAIHPLGKSPVVTDEG
RTYAESGAIIEYLVERYGNGRMAPPPGAPERHDYTYWLHYAEGSAMPPLLLKLVALRIAH
APMPFFARSIARKIADTLQSGFVDPQIALHLGYVDDTLSRTGWFVGDGFSAADIQMSFPL
EAATARGGGSRYPAIARFLDAIHARPAYQRALERGGPYDLLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtccaccacctgaacaactcgcgctcgcagcgcgtgctctggctgctcgaa
gaactggatgtgccgtacgagatcgtgcgctacgcgcgtgatccgaagacgatgctcgcg
ccgcccgcgttgcgcgcgatccatccgctcggcaagtcgcccgtcgttaccgacgaaggc
cgcacgtacgccgaatcgggcgcgatcatcgaatacctggtcgaacgctacggcaatgga
cgcatggcgccgccgcccggcgcgcccgagcggcacgactacacgtactggctgcactac
gcggaagggtcggcgatgccgccgctgctgctcaagctcgtcgcactgcggatcgcgcat
gcgccgatgccgttcttcgcacggtcgatcgcgcgcaagatcgccgacacgctgcaatcg
ggcttcgtcgatccgcagatcgcgctgcatctcggctatgtcgacgacacgttgagccgc
accggctggttcgtcggcgacggtttcagcgcagccgacatccagatgagctttccgctc
gaagcggcgaccgcgcgcgggggcggcagccggtatcccgcgatcgctcgctttctcgat
gcgatccacgcgcggcccgcgtaccagcgggcgctggagcgcggcggcccgtacgacctg
ctcaaataa

DBGET integrated database retrieval system