KEGG   Burkholderia contaminans: NL30_11590
Entry
NL30_11590        CDS       T03969                                 

Definition
(GenBank) cytochrome C1
  KO
K07518  hydroxybutyrate-dimer hydrolase [EC:3.1.1.22]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_11590
Enzymes [BR:bcon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.22  hydroxybutyrate-dimer hydrolase
     NL30_11590
SSDB
Motif
Pfam: 3HBOH
Other DBs
NCBI-ProteinID: AKM40485
LinkDB
Position
1:complement(2636160..2638250)
AA seq 696 aa
MTRLGWGRRMVFGAALAAVAILGACNGDESAERNRLPGFVSGSVRTTAYDGASDDLLTAG
LGKTGLGSASAPGFANAARPTSAELRRLAIWSNYRALVDMSANGGYGRFWGPNVDLDGND
TLGEGKIPGTEYLAYADDGSGSKNVTLLVQVPASFNPAQPCIVTATSSGSRGVYGAISAA
GEWALKRGCAVAYNDKGGGNGAHELMSDTITLIDGTLANAVLAGTASLFTANVTSGELAA
FNSRFPNRYAFKHAHSQQNPEQDWGRVTLQSVEFAYWALNEQFAPLIDGSHHGVRYRAGD
VTTIAASVSNGGGASLAAAEQDNRGWITAVVVGEPQINVRMAPNAVVRSGGQPVPSFGRP
LADYATLANLLEPCAAASASLADAPSLSALPAATTQSIRTQRCATLAAAGLVSGADTQSQ
AADALAQLHAAGYLADSDLLQAPMWDSQAIPAIAVTYANAYTRSRVTDNLCNFSFATTNP
ATGAVAAPATSPMPAVFGVGNGVPPTAGINLVFNTGAGVDHRLATPDASFAGALCLRQLW
TNGMLGMPANVDAVRVNANLQGKPAIIVQGRSDALVPVNHASRAYVAQNGISEGGRSQLV
FYEVTNGQHFDAFLPVPGFDTRFVPVHYYNLQALNLMWKHLKNGAPLPPSQVIRTVPRGG
TPGAAPALTGANLPPISAAPGANAITVGAGAIDVPL
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgacgaggctcgggtggggcaggcggatggttttcggcgcggcgctggccgcggtcgcg
atactcggcgcctgtaacggcgacgaatcggccgagcgcaaccggttgcccggtttcgtg
tccggcagcgtgcgcacgacggcctatgacggcgcgagcgacgacctgctgacggccggc
ctcggcaagacgggcctcggctcggcgagcgcccccggctttgcgaatgccgcccggccg
acgagcgccgagctgcgccgtctcgcgatctggtcgaactatcgcgcactcgtcgacatg
agcgcgaacggcggctacggccgcttctgggggccgaacgtcgacctcgacggcaacgac
acgctcggcgaaggcaagattcccggcaccgaatatctcgcgtacgccgacgacggcagc
ggcagcaagaacgtcacgctgctcgtgcaggtgcccgccagcttcaatcccgcgcagccg
tgcatcgtcaccgcgacgtcgtcgggctcgcgcggcgtgtacggcgcgatttccgcggcc
ggcgaatgggcgctcaagcgcggctgcgcggtcgcctacaacgacaagggcggcggcaac
ggcgcgcacgagctgatgtcggacaccatcacgttgatcgacggcacgctcgccaacgcg
gtgctggccggcactgcgagcctgtttaccgcgaacgtcaccagcggcgagctcgccgcg
ttcaattcccgcttcccgaaccgctatgcgttcaagcacgcgcattcgcagcagaatccc
gagcaggactgggggcgcgtgacgctgcagtcggtcgagttcgcgtactgggcgctcaac
gagcagttcgcgcccctgatcgacggctcgcaccacggcgtgcgctatcgcgcgggcgac
gtcacgacgatcgccgcgtcggtcagcaacggcggcggcgcgtcgctcgcggcggccgaa
caggacaaccgcggctggatcaccgcggtcgtggtcggcgagccgcagatcaacgtgcgg
atggcgccgaacgcggtcgtgcgctcgggcggccagcccgtgccgtcgttcggccggccg
ctggccgactacgcgacgctcgcgaacctgctggagccatgcgcggccgcgtcggcatcg
cttgccgacgcgccgtccctgagcgcgctgccggcggcgaccacgcagtcgatccgcacc
cagcgctgcgcgacgctcgccgcggcggggctcgtgtcgggcgccgatacgcaaagccag
gccgccgacgcgctcgcgcagctccacgcggccggctacctcgccgattccgacctcctg
caggcgccgatgtgggattcgcaggcgattccggcgatcgcggtcacgtatgcgaacgcg
tacacgcgctcgcgcgtcaccgacaacctgtgcaatttcagcttcgcgacgacgaacccg
gcgacgggcgccgtcgccgcgccggccacgtcgccgatgccggccgtgttcggcgtcggc
aacggcgtgccgccgacggccggcatcaacctcgtgttcaacacgggcgcgggcgtcgat
caccggctcgccacccccgatgcaagcttcgcgggcgcgctgtgcctgcgccagctctgg
acgaacgggatgctcgggatgcccgcgaacgtcgacgcggtgcgcgtgaacgcgaacctg
cagggcaagccggcgatcatcgtgcagggccgcagcgacgcgctcgtgcccgtgaaccac
gcgtcgcgcgcgtatgtcgcgcagaacggcatcagcgaaggcggacgcagccagctcgtg
ttctacgaggtgacgaacggccagcacttcgacgcgttcctgccggtgccgggcttcgac
acgcgcttcgtgccggttcattactacaacctgcaggcgctgaacctgatgtggaagcac
ctgaagaacggcgcaccgctgccgccgtcgcaggtgatccgcacggtgccgcgcggcggc
acgccgggcgccgcgcccgcgctgacgggcgcgaacctgccgccgatctcggccgcgccg
ggcgcgaacgcgatcacggtcggcgccggcgcgatcgacgtgccgctctga

DBGET integrated database retrieval system