KEGG   Burkholderia contaminans: NL30_12610Help
Entry
NL30_12610        CDS       T03969                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00473  D-Alanine metabolism
bcon01100  Metabolic pathways
bcon01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NL30_12610
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NL30_12610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcon01011]
    NL30_12610
Enzymes [BR:bcon01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NL30_12610
Peptidoglycan biosynthesis and degradation proteins [BR:bcon01011]
 Precursor biosynthesis
  Racemase
   NL30_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKM40665
UniProt: A0A0G3YT88
LinkDB All DBs
Position
1:2858977..2860047
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYVPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ESIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSSDIAETGLKPAMTLASELI
AVQTIGKGQAIGYGSTFSAQAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCGTIGYELMCAVAGRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccataccgccgctctcgcgaacaatctctccgtc
gtccgccgctttgccggcccgtccaaggtctgggcggtcgtcaaggccaacgcgtacggt
cacggtctcgcgcgtgtgtttcccggcctgcgcggcaccgacggcttcggcctgctggac
ctcgacgaggccgtcaagctgcgcgagctcggctgggccggcccgatcctgctgctcgaa
gggttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctgacgacgaccgtc
cacaacgacgagcagatgcggatgctggaaacggcgcggctgtcgaagcccgtcaacgtg
cagctcaagatgaacagcgggatgaaccggctcggttacgtgccggagaaatatcgtgct
gcgtgggaacgcgcccgcgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggatgcggacaacgagcgcggcgtcgccgagcagctcgcgacgttcgagcgcggcgcg
gaaagcatcgccggcgcgcgcagcctcgcgaactccgcggccgtgctgtggcatccggat
acccacttcgactgggtgcgcccgggtatcgtgctgtacggcgcgtcgccgtccggtctg
tcgtccgacatcgccgaaaccgggctgaagcccgcgatgacgctcgcgtccgaactgatc
gcggtgcagacgatcgggaagggccaggccatcggctatggctcgacgttctccgcgcag
gcgccgatgcggatcggcgtggtcgcgtgcggttacgcggacggctatccgcgggtcgcg
cccgaaggcacgcccgtgatcgtcgacggcatccgcacgcggatcgtcggtcgcgtatcg
atggacatgatcaccgtcgacctgaccccgtgcccgcaggccggtgtcggcgcgcgcgtc
gaactgtggggcaacgcgctgccgatcgacgacgtcgcccgccattgcggcacgatcggc
tacgagctgatgtgcgcggtcgccggccgcgtgcccgtgcgcgcggaataa

DBGET integrated database retrieval system