KEGG   Burkholderia contaminans: NL30_14660Help
Entry
NL30_14660        CDS       T03969                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bcon  Burkholderia contaminans
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NL30_14660
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     NL30_14660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AKM41036
UniProt: A0A0G3YSK4
LinkDB All DBs
Position
1:3294652..3295356
Genome map
AA seq 234 aa AA seqDB search
MSDLSAFPITQKWPAQHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLSP
AFLSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPKDLAGRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGRDYEDKRPRDRYVDESKRLLGVLDAHLANRQWVMGDTYT
IADIAIFPWVRNLVGFYEAGDLVGFSEFRNVKRVLDAFVARPAVERGLNIPARG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgtccgccttcccgatcacgcaaaagtggccggcccagcatcccgaccgt
ctccagctctactcgctgccgacgccgaacggcgtcaaggtgtcgatcatgctcgaggaa
accggcctgccgtacgagccgcacctcgtgcgcttcgacacgaacgaccagctgtcgccg
gcattcctgtcgctgaacccgaacaacaagatcccggcgatcatcgatccgaacggcccg
gacggcaagccgctgccgctgttcgaatcgggcgcgatcctgatctatctcgcggacaag
acgggccagttgatcccgaaggatctcgcgggccgctacgagacgatccagtgggtgatg
ttccagatgggcggcatcgggccgatgttcggccaggtcggcttcttccacaagttcgcc
ggccgcgattacgaggacaagcgcccgcgcgaccgttacgtcgacgagtcgaagcgtctg
ctcggcgtgctcgacgcgcatctcgcgaaccggcaatgggtgatgggcgatacctatacg
atcgccgacatcgcgattttcccgtgggtgcggaacctcgtcgggttctatgaagcgggt
gatctcgtgggcttcagcgaattccggaacgtcaagcgggtgctcgacgcgttcgttgcg
cggccggcggtcgagcgcgggctcaatattcccgcgcggggttga

DBGET integrated database retrieval system