KEGG   Burkholderia contaminans: NL30_16615Help
Entry
NL30_16615        CDS       T03969                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00250  Alanine, aspartate and glutamate metabolism
bcon00410  beta-Alanine metabolism
bcon00640  Propanoate metabolism
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
bcon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NL30_16615
   00650 Butanoate metabolism
    NL30_16615
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NL30_16615
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NL30_16615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcon01007]
    NL30_16615
Enzymes [BR:bcon01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NL30_16615
Amino acid related enzymes [BR:bcon01007]
 Aminotransferase (transaminase)
  Class III
   NL30_16615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKM41591
UniProt: A0A0G3YU77
LinkDB All DBs
Position
2:218917..220206
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINDRAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtt
ggcgtgatgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacaccggccaccgccac
ccgaagatcgtcaaggcgatcgcggatcagttgaacaacttcacgcacaccgcctaccag
atcgtcccgtacgcgtcgtacgtcgagctggctgaaaagatcaacgaccgcgcgccgggc
gatttcccgaagaagaccgcgttcttcacgaccggcgcggaagccgtcgagaacgcgatc
aagatcgcgcgcgcagcgaccggccgtccgggcgtcatcgccttctcgggcggtttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgctccgtacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gagttcgtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagccttgcaggcggcatgccgctgtcgggcgtc
gtcggccgcgctgacgtgatggacgcggcggctcccggcggcctcggcggcacgtacgcg
ggcaacccgctggccgtcgcgtcggcacacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgcgcgacgcaactgggcgacgtgctgaaggcgaagctgaacgcactgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggctcgggcgagccggatgcggaattcacgaagcgcgtgcagacgcgtgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system