KEGG   Burkholderia contaminans: NL30_17025
Entry
NL30_17025        CDS       T03969                                 

Definition
(GenBank) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00061  Fatty acid biosynthesis
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon01120  Microbial metabolism in diverse environments
bcon01200  Carbon metabolism
bcon01212  Fatty acid metabolism
Module
bcon_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_17025
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NL30_17025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcon01004]
    NL30_17025
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NL30_17025
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     NL30_17025
Lipid biosynthesis proteins [BR:bcon01004]
 Fatty acid synthase
  Component type
   NL30_17025
SSDB
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Other DBs
NCBI-ProteinID: AKM41667
UniProt: A0A0G3YW80
LinkDB
Position
2:307116..308318
AA seq 400 aa
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARIS
AAFGSDADTLGVFFERAGSETKPGTAGWYNSAAFEKFAAEKGRYARSINGDAFSDKVKQV
TIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKTVTFRGLDTDKEVIRDVT
LEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSI
GEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKTMKENGT
HEGCIEQVYGLFKDSLYGATPHVDAEGRLRADYKELDPQVQAKVVAQWNHVTNENLYELT
DFTGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIDTTV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtgcgtggcttcatctgcgtgacgactcatccggtcggctgc
gaagccaacgtcaaggaacagatcgactacgtgacttcgcacggcccgatcgccaacggc
ccgaaaaaggtgctcgtgatcggcgcgtcgaccggctacggcctcgctgcccggatctcg
gccgccttcggctccgacgcggacacgctcggcgtgttcttcgagcgcgccggcagcgag
acgaagcccggcacggccggctggtacaacagcgccgcgttcgagaaattcgccgccgaa
aaggggcgctatgcgcgcagcatcaacggcgacgcattctccgacaaggtgaagcaggtc
acgatcgacaccatcaagcaggatctcggcaaggtcgatctcgtcgtctacagcctcgcg
gcgccgcgccgcacgcatccgaagacgggcgaaaccatcagctcgacgctcaagccgatc
ggcaagacggtcacgttccgcggcctcgacaccgacaaggaagtgatccgcgacgtcacg
ctggaaccggcgacgcaggaagagatcgacggcaccgtcgccgtgatgggcggcgaggac
tggcagatgtggatcgacgcgctcgatgaagccggcgtgctggccgacggcgcgaagacc
accgcgttcacgtatctcggcgagcagatcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgacaagaaggtgctgtcgatccgcgacaagctcgccgcg
cacggcggcgacgcacgcgtgtcggtgctgaaggccgtcgtcacgcaggccagctcggcg
atcccgatgatgccgctgtacctgtcgctgctgttcaagacgatgaaggaaaacggcacg
cacgaaggctgcatcgagcaggtgtacggcctgttcaaggacagcctgtacggcgcgacg
ccgcacgtcgacgcggaaggccgcctgcgcgcggactacaaggagctcgatccgcaagtt
caggcgaaggtcgtcgcgcagtggaaccacgtgacgaacgagaacctgtacgagctgacc
gacttcaccggctacaagaccgagttcctgcgtttgttcggcttcgagatcgccggcgtc
gactacgacgcggacgtgaacccggacgtgaagatcccgggcatcatcgacaccaccgtc
tga

DBGET integrated database retrieval system