KEGG   Burkholderia contaminans: NL30_20385Help
Entry
NL30_20385        CDS       T03969                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bcon  Burkholderia contaminans
Pathway
bcon03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    NL30_20385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcon03400]
    NL30_20385
Enzymes [BR:bcon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     NL30_20385
DNA repair and recombination proteins [BR:bcon03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     NL30_20385
 Prokaryotic type
     NL30_20385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AKM42274
LinkDB All DBs
Position
2:complement(1058139..1059044)
Genome map
AA seq 301 aa AA seqDB search
MATRKTSRAPQQASLFDDPVPETAPADIPPPAPEAPAAGRTPAKKAAAPAAAPTVPQPVA
ADVPHLAAQFDALPPVWRDVLKPFTDSDAYAPLCRFVDDERAAGKTVYPTDVFRALRLTS
PDDVKVVILGQDPYHGDDRGTPQAHGLAFSVPPAVRTPPSLRNIFKEIAANFGHDTPRHG
CLDTWARQGVLLLNTVLTVERGAAASHAKRGWEQCTDTLIRELAGRHQGLVFMLWGAHAQ
AKRALFDASAHRVLEAPHPSPLSAHRGFLGCRHFALANDYLVEAGREPIDWRLPEVAETL
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccgcaagacttcccgcgcgccgcaacaggcgtcgctgttcgatgatcccgtg
ccggaaacggcaccggccgatattccgcccccggcgcccgaagcgcccgcggccggacgc
acgcccgcaaagaaagccgcggctccggctgcagcccccacggtaccgcagcccgttgcc
gccgacgttccgcacctcgccgcgcaattcgacgcgctgccgcccgtctggcgagacgtg
ctgaaaccctttaccgacagcgacgcgtacgcgccgctgtgccgcttcgtcgatgacgag
cgtgcggccggcaagacggtctacccgaccgacgtgttccgcgcgctgcgcctgacgagc
ccggacgacgtaaaagtcgtgatcctcggccaggatccgtaccacggcgacgatcgcggc
acgccgcaggcgcacgggctcgcgttctcggtgccgccggccgtgcgcacaccgccgtcg
ctgcgcaacatcttcaaggaaatcgccgcgaacttcggccatgacacgccgcgccacggc
tgcctcgacacttgggcgcgccagggcgtgctgctgctcaacacggtgctgacggtcgag
cgcggtgccgccgcgagccatgcgaagcgcggctgggagcaatgcacggacacgctgatc
cgagaactcgccggccgccatcaggggctcgtcttcatgctgtggggcgcacacgcgcag
gcgaagcgtgcgctgttcgacgccagcgcgcatcgcgtgctcgaggcgccgcatccgtcg
ccgctgtccgcgcaccgcggcttcctcggctgccgccatttcgcgctcgcaaacgactat
ctggtcgaggcaggccgcgaaccgatcgactggcgcctgcctgaagtggcggaaacgctc
gcgtaa

DBGET integrated database retrieval system