KEGG   Burkholderia contaminans: NL30_25275Help
Entry
NL30_25275        CDS       T03969                                 

Definition
(GenBank) MFS transporter
Organism
bcon  Burkholderia contaminans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AKM43124
LinkDB All DBs
Position
2:2155075..2156379
Genome map
AA seq 434 aa AA seqDB search
MTSSTSSRSAWSYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNTQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAHGWREAFYVSC
VPGFLIAFCIWRWVREAPPGGVRHAQAEPAGTPAASGAAVSRWALLKERNILLCMLISCF
FLTWFIVIISFAPVFLVESRHLSPSDMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIV
FALIAAVCPVVMIHAGSLWALGALVFATYTGLGCFTLFMATIPAETVPPRAIASALGLIM
AAGELIGGFVAPTVAGFAADKYGLQFAMWTSAAGAVLACVLSFGLVETAPAVLRKRALAG
TAASRLDAHNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctccacctcctcccgatccgcgtggtcgtatgagaacaggctgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtcggccgagctgcacctgacgaacacgcagctcggcatggtgtcgtccgcgctc
gcgctcacgtgggcactgtccggcgccgcgacgggcgcgtggtcagacgcgcgcggcacg
cgcaagccgctgctgatcgcggccgtgctcggcttttccgtgtgctcggcgctgtcgggg
ctcgtcggcggcttcgcgagcctgatcgcgttccgcgcgctgatgggcatcgccgaaggc
cccgtgctgccgctgtcgcaatcgctgatggtcgaaagctcgacgccgagccgccgcggg
ctgaacatgggcctgctgcaaggctccgccgccggcctgctcggcgcgatgatcggcccg
ccggtggtcatcggcatcgcgaccgcgcacggctggcgcgaagcgttctacgtatcgtgc
gttccgggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagcgccgcccggc
ggcgtgcggcacgctcaggccgaacccgccggcacaccggccgcgagcggcgcggcagtc
agccgctgggcgttgctgaaggagcgcaacatcctgctctgcatgctgatcagttgcttc
tttctcacgtggttcatcgtgatcatctcgttcgcgccggtattcctcgtggaaagccgc
catctgtcgccgtccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggctttgcggtgccggcgatctccgaccggatcggccgcaagccgacgatgatcgtg
ttcgcgctgattgcggccgtgtgcccggtcgtgatgatccatgccggttcgctctgggcg
ctcggcgcgctcgtgttcgccacgtacacgggcctcggctgcttcacgctgttcatggcg
acgatcccggcggaaacggtgccgccacgcgcgatcgccagcgcgctcggcctgatcatg
gccgcgggcgagctgatcggcggcttcgttgcgccgaccgtcgccggcttcgcggcggac
aagtacggcctgcagttcgcgatgtggacgtcggccgccggtgcggtcctcgcatgcgtg
ctgtcgttcggcctcgtcgagaccgcgcccgccgtgctgcgcaagcgcgcgctcgccggc
actgccgcgagccgtctcgatgcacacaacctcggaggacgctga

DBGET integrated database retrieval system