KEGG   Burkholderia contaminans: NL30_25280Help
Entry
NL30_25280        CDS       T03969                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_25280
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NL30_25280
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NL30_25280
    1.1.1.-  
     NL30_25280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AKM43125
LinkDB All DBs
Position
2:2156381..2157502
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVEIDPPRVGPGDVRIAVAYCGICGSDLHEYADGPHAIPVDTPHPLS
RRTAPLTLGHEFCGTVVEVGGDVTALRAGDRVAVEPEYRCHQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPSYMLHRLPDAVSLEQAAVMEPAAVALHALRRGELRLGETCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPERLAAATRFGATHTFDARALGAPALQDAIRAATG
GLGVDASFEAAGLPATFEAAMQALRKGGRVVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HAYEDLLRIVASGALDLTSIVTRTVSLEDAVADGFDALLADRAQIKILVSPAQRPARRAH
TIGSVEHESSVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcacttcaatggcatggcccgcgcgacgtccgtctcgtggaaatcgacccgccg
cgcgtcggccccggcgacgtgcgcatcgcggtcgcgtattgcgggatctgcggcagcgac
ctgcacgaatatgcggacggcccgcatgcgatcccggtcgacacgccgcatccgctgtcg
cgccgcactgcgccgctgacgctcggccacgagttctgcggcaccgtcgtcgaagtcggt
ggcgacgtgacggcactgcgcgcgggcgatcgcgtcgcggtcgagcccgagtatcgctgc
caccagtgcgcgtactgccgctcggggtcgtacaacctgtgcgtgtcgatgggcttcgcc
gggctgatgggcgacggcggcatggccgacttcgcggtcgtgccgtcatacatgctgcat
cgcctgcctgacgccgtgagcctcgaacaggccgcggtgatggagccggcggccgtcgcg
ctgcacgcgttgcggcgcggcgaactgcggctcggcgagacctgcgcggtattcgggctc
gggccgatcgggctgctgctgatcatgctcgcgaagctgcaaggggcgaccacgatcgtg
gccgtcgacgtctcgcccgaacggctcgcggcagccacgcgcttcggcgcaacgcatacg
ttcgatgcacgcgcactcggcgcacccgcgctacaggacgcgattcgcgcggccacgggc
gggctcggtgtcgacgcgagcttcgaagcggccgggttgccggccacgttcgaagcggcg
atgcaggcactgcgcaagggcggccgcgtcgtgatggtcggcctgatgccgcacgccggc
ttcgacgcgttccgcgcagtcaacgacgagctgaccttcaccgcgagcgtcggctaccgg
catgcgtacgaagacctgctgcgcatcgtcgcgtcgggcgcactcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaagacgccgtcgccgacggcttcgacgcgctgctcgcc
gaccgcgcgcagatcaagatcctcgtttcacccgcgcaacggccggcccgtcgcgcacac
accatcgggagcgtcgagcatgagtcgtcagtgggcgtttga

DBGET integrated database retrieval system