KEGG   Burkholderia contaminans: NL30_25285Help
Entry
NL30_25285        CDS       T03969                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bcon  Burkholderia contaminans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR RmlD_sub_bind NAD_binding_10 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AKM43126
UniProt: A0A0G3YYH8
LinkDB All DBs
Position
2:2157480..2158202
Genome map
AA seq 240 aa AA seqDB search
MSRQWAFEGRSVVVTGGTSGIGARTAMRFAQAGASVVALGLDAAGPHAPVHAGIRCVELD
VTDSDALTRTIAALPRLDVLVNGVGISRHADEYRMDQFELVLNVNLTSVMRASDAARPAL
SANGGSIVNVASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSSGLKADMQASRRILERTPLGRWGTADEVADVILFLCSPGASFVTGAVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcagtgggcgtttgagggccggtccgtcgtcgtgacgggcggcacgtcgggc
atcggtgcgcgcacggcgatgcggttcgcgcaagccggcgcgtcggtcgtcgcgctcggg
ctcgatgcggccggcccgcatgcgcccgtgcatgcaggcatccgctgcgtggaactggac
gtgaccgacagcgatgcgctgacccgcaccatcgcggcgctgccgcggctcgacgtgctc
gtcaacggcgtcggcatcagccggcacgcggacgagtaccggatggaccagttcgagctc
gtgctgaacgtgaacctgacgtcggtgatgcgggcatccgacgccgcacggccggcattg
tcggcaaacggcggcagcatcgtcaatgtcgcgtcgatgtacacgtacttcggcagcaag
gatcgccccgcatacagcgcgagcaagggcggtatcgcgcagctcacgcgctcgctcgcg
caggcgtgggccgatcgcggcattcgcgtgaacgcggtcgcgcccggctggatcgacacg
ccgctcagcagcggcctgaaggccgacatgcaggcgtcgcgccgcatcctcgaacgcacg
ccgctcgggcgttggggcacggccgacgaagtcgcggacgtgatcctgttcctgtgctcg
cccggcgcatcgttcgtgaccggcgcggtcgtgccggtcgacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system