KEGG   Burkholderia contaminans: NL30_26480Help
Entry
NL30_26480        CDS       T03969                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00564  Glycerophospholipid metabolism
bcon01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NL30_26480
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NL30_26480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 Pyr_redox_2 3HCDH_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AKM43343
LinkDB All DBs
Position
2:2415314..2416837
Genome map
AA seq 507 aa AA seqDB search
MTQPNRYDLLVVGGGINGAGIARDAAGRGLSVMLCEQDDLASHTSSSSTKLIHGGLRYLE
YNEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHAAGAPLIDSIKRGFVYSDGWVDDARLVVLNAMDAKERGAQILTRTKLVS
AERRGDEWEARLQHADGSTRVVHARAIANAAGPWVGEVLKGALGRGAHHSVRLVKGSHII
TRRLFDHDHAYIFQNPDKRIIFAIPYEHDFTLIGTTDVEYTNDPAKVAIDRDETQYLCDS
INRYFKRKISPADVHWTYSGVRPLLEDENAANASAVTRDYRLELDDGAGAPLLSVFGGKI
TTFRKLAEEAGDMLCNALGRDAKTWTAGVALPGGDIANAKFDAFADTFAKRHAWLPAALA
RRYARAYGTRAERLIDGAKSLADLGTEIAPGIYDAELRYLRDAEWATCAQDVLWRRSKLG
LHVAPGTLDAVTAAVDAWFAAAHAPHA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaaccgaatcgctacgatctgctcgtcgtcggcggcggcatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtcatgctctgcgagcaggacgatctc
gcgtcgcacacgtcgtcgtccagcacgaagctgattcacggcggcctgcgctacctcgag
tacaacgagttcgggctcgtgcgcaaggcgctgcaggaacgcgagacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgtccg
gcctggctgatccgcatcgggctgttcctctacgatcatctcgcgaaacgcgagctgctg
cccggctcgcgcggcatcgacatgcgccgccatgcggccggcgcgccgctgatcgattcg
atcaagcgcggcttcgtctattcggacggctgggtcgacgacgcgcgcctcgtcgtgctg
aacgcgatggatgcgaaggagcgcggcgcccagattctgacgcgcacgaagctggtgtcc
gccgaacgccgcggcgacgaatgggaagcgcggctgcagcacgccgacggctcgacccgc
gtcgtgcatgcgcgcgcgatcgcgaacgcggccggcccgtgggtcggcgaagtgctgaaa
ggcgcactcggccgcggcgcgcaccacagcgtgcggctcgtgaagggcagccacatcatc
acgcgccgcctgttcgatcacgatcacgcgtacatcttccagaacccggacaagcggatc
atcttcgcgattccgtacgagcacgatttcacgctgatcggcaccaccgacgtcgaatac
acgaacgatcccgcgaaggtcgcgatcgatcgcgacgagacgcagtacctgtgcgattcg
atcaaccgctacttcaagcgcaagatctcgccggccgacgtgcactggacctactcgggc
gtgcgcccgctgctggaagacgagaacgccgcgaacgcgtcggccgtcacgcgcgactac
cgcctcgagctggacgacggtgcgggcgccccgctgctgtcggtgttcggcggcaagatc
acgacgttccgcaagctcgcggaagaagccggcgacatgctgtgcaacgcgctcggccgc
gacgcgaagacctggacggccggcgtcgcactgccgggcggcgacatcgcgaacgcgaag
ttcgacgcattcgccgatacgttcgccaaacgccatgcgtggctgcccgccgcgctcgcc
cgccgctatgcgcgtgcatacggcacgcgcgcggagcgcctgatcgacggcgcgaagtcg
ctcgccgatctcggcaccgaaatcgcaccgggcatctacgatgccgaactgcgctacctg
cgcgacgccgaatgggcgacctgcgcgcaggacgtgctgtggcgccgctcgaagctcggc
ctgcacgtcgcgcccggcacgctcgacgcggtgaccgccgcggtcgacgcgtggttcgcg
gccgcgcacgcgccgcacgcctga

DBGET integrated database retrieval system