KEGG   Burkholderia contaminans: NL30_26490Help
Entry
NL30_26490        CDS       T03969                                 

Definition
(GenBank) glycerol transporter
  KO
K02440  glycerol uptake facilitator protein
Organism
bcon  Burkholderia contaminans
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcon02000]
    NL30_26490
Transporters [BR:bcon02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    NL30_26490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AKM43345
UniProt: A0A0G3Z0V8
LinkDB All DBs
Position
2:2418528..2419244
Genome map
AA seq 238 aa AA seqDB search
MSPYIAEFIGTAILVLLGNGAVANVLLAKTKGKGADLIVIVMGWAMAVFVAVYVTASFSG
AHLNPIVTISLALAGKFAWSKVGGYVLAQMLGGMAGALLVWLAYRQHFAKEADADLKLAV
FCTAPAIRSVTHNVLTEAICTFVLILGVLYLASPQVGLGALDALPVGLLVLGIGISLGGP
TGYAMSPARDLSPRIMHALLPIPGKRDSDWRYAWVPVVGPLLGGAAAAGLYLHLHAMA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccttatattgcggaattcatcggcacggcgatcctcgtgctgctcggcaacggc
gcggtcgcaaacgtgctgcttgcaaagaccaagggcaaaggcgcggacctgatcgtgatc
gtgatgggctgggcgatggccgtattcgtcgccgtctacgtgaccgcgtcgttcagcggc
gcgcacctgaacccgatcgtcaccatcagcctcgcgctcgcgggcaagttcgcatggtcg
aaagtcggcggctacgtcctcgcgcagatgctcggcgggatggcgggcgcgctgctcgtg
tggctcgcctatcgccagcacttcgcgaaggaagccgatgcggacctgaagctcgcggtg
ttctgcacggcgcccgcgatccgcagcgtcacgcacaacgtgctgaccgaagcgatctgc
acgttcgtgctgatcctcggcgtgctgtacctcgcgtcgccgcaagtcggcctcggcgca
ctcgacgcactgcccgtcggcctgctcgtgctcggcatcggcatctcgctcggcggcccg
accggctatgcgatgagccccgcgcgcgacctgtcgccgcgcatcatgcatgcgctgctg
ccgatccccggcaagcgcgacagcgactggcgctatgcatgggtgcccgtcgtcggtccg
ctgctcggcggcgccgcagcagccggcctgtacctgcacctgcacgcgatggcctga

DBGET integrated database retrieval system