KEGG   Burkholderia contaminans: NL30_28370Help
Entry
NL30_28370        CDS       T03969                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bcon  Burkholderia contaminans
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NL30_28370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: AKM43693
UniProt: A0A0G3Z1Y8
LinkDB All DBs
Position
2:2825578..2826984
Genome map
AA seq 468 aa AA seqDB search
MSLFRKKNVDRMIAGAHAAGLKKALGAIDLTFLGIGAIIGTGIFVLTGTGAVQAGPALML
SFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWIIGWDLMLEYGLASSAV
SVGWSGYLQSLLQGFGLTLPTVLTAAPGAVPGVVTWFNLPAFLVMIVITTLLSIGIREST
RINNIMVFIKVSVVLLVIAVGVFHVTPANWKPFMPHGWNGVFGAAAVMFFAFIGFDAVSS
AAEEVKNPKRDLPIGIIASLAVCAVLYVTVAAVATGIVPSAQYANISHPISYALQKAGET
WVAGFIDLGAVLGMLTVILVMSYGQTRVIFAMSRDGLLPAALSRVHPRYATPFLTTWLVG
LFFGLIAALVPLNVLAELINIGTLAAFSMVSIAVLVLRRTHPDLPRAFRCPGVPVVPILA
VASCLFLMLNLQPVTWAAFGIWLVIGLVIYFLYSRHHSKLAHGHHDAH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcttccgcaagaaaaacgtcgatcgcatgatcgccggcgcgcatgccgccggg
ctcaagaaagcgctcggcgcaatcgacctcaccttcctcggcatcggcgcgatcatcggc
accggcatcttcgtgctgaccggtaccggcgccgtgcaggccggccccgcactgatgctg
tcgttcgtgatcgccgcgatcgcgtgcggcctcgccgcgctgtcgtacgcggagttcgcg
tcgacgatccccgtcgccggctcgatctacacgtactcgtacgccaccctcggcgagctc
gtcgcgtggatcatcggctgggacctgatgctcgaatacggtctcgcatcgtcggccgtg
tcggtcggctggtccggctacctgcagtcgctgctgcagggcttcgggctcacgctgccc
accgtgctgacggccgcgcccggtgcggtgccgggcgtcgtcacgtggttcaacctgccc
gcgttcctcgtgatgatcgtgatcacgacgctgctgtcgatcggcatccgggagtcgacc
cgcatcaacaacatcatggtgttcatcaaggtgtcggtcgtgctgctcgtgatcgcggtc
ggcgtgttccacgtgacgcccgcgaactggaagccgttcatgccgcacggctggaacggc
gtgttcggcgcggcagccgtgatgttcttcgcgttcatcggcttcgacgcggtgtcgtcg
gcggccgaggaagtgaagaacccgaagcgcgacctgccgatcggcatcatcgcgtcgctc
gcggtgtgcgcggtgctgtacgtgacggtcgccgcggtcgcgaccggcatcgtgccgtcg
gcccagtacgcgaacatctcgcacccgatctcgtatgcgctgcagaaggccggtgaaacg
tgggtggcgggcttcatcgatctcggcgccgtgctcggcatgctgacggtgatcctcgtg
atgagctacggccagacgcgcgtgatcttcgcgatgtcgcgcgacgggctgctgcccgcg
gcgctgtcgcgcgtgcaccctcgctacgcgacgccgttcctgacgacctggctcgtcggc
ctgttcttcgggctgatcgccgcgctcgtgccgctcaacgtgctcgccgagctgatcaac
atcggcacgctcgccgcgttctcgatggtgtcgatcgccgtgctcgtgctgcgccgcacg
caccccgacctgccgcgtgcgttccgctgccccggcgtgccggtggtgccgatcctcgcg
gtcgcgtcgtgcctgttcctgatgctgaacctgcagcccgtcacgtgggccgcgttcggc
atctggctcgtgatcggcctcgtgatctacttcctgtactcgcgccaccactcgaagctc
gcgcacggtcaccacgacgcgcactga

DBGET integrated database retrieval system