KEGG   Burkholderia contaminans: NL30_32710
Entry
NL30_32710        CDS       T03969                                 

Definition
(GenBank) aminotransferase
  KO
K16871  4-aminobutyrate---pyruvate transaminase [EC:2.6.1.96]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00250  Alanine, aspartate and glutamate metabolism
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
bcon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_32710
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NL30_32710
Enzymes [BR:bcon01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.96  4-aminobutyrate---pyruvate transaminase
     NL30_32710
SSDB
Motif
Pfam: Aminotran_3 LGT Gpi16
Other DBs
NCBI-ProteinID: AKM44684
UniProt: A0A6P2WBG8
LinkDB
Position
3:complement(426584..427954)
AA seq 456 aa
MHTLKQNDIDHVLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGF
SESRLADAADRQMRKLPFYHAFGHKSSEPSILLAEKLIAMAPVPMSKVFFANSGSEANDT
AMKLIWYYNNALGRPLKKKIIARTRAYHGVTIASASLTGLPNNHRDFDLPIDRILHTDCP
HYYRHALPGESEEQFATRCAESLEQLILREGPDTIAAFFAEPIMASGGVIVPPATYMEKI
QRVLKRYDILLVADEVICGFGRTGNMFGSETFGMQPDMIVVAKQLSAGYLPISALMVNDA
IYRALVAESEKIGTFGHGFTYSGHPVCAAVALETLRIYDEDGVLDHVRSVIPHFQQRVAD
LAGHPLVGEARGAGLLAAVELVADKATKTPFPPSEGVAAHAGERALAYGVITRALGDAFN
FCPPLIITHDEIDQLFDASKRALDDTLAWRRSLAAR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcacactctgaagcagaacgacatcgatcacgtccttcatccgtacacgaacctgagc
cgccatcgcgatgtcgggccgatggtgatcgagcgcggcgagggcgtctacgtgtacgac
acggaaggcaaccgctatatcgaagcgctgagcggcctgttctgcgcgtcgctgggattc
agcgaatcgcggctcgccgacgcggcggaccggcaaatgcgcaaactgccgttttatcac
gcgttcggtcataagtcgtccgaaccgtcgatactgcttgccgagaaactgatcgcgatg
gcgcccgtgccgatgtcgaaggtgttcttcgcgaactcgggttccgaagccaacgacacc
gcgatgaagctgatctggtattacaacaacgcgctcgggcggccgctgaagaaaaagatc
atcgcacgcacgcgggcgtaccacggcgtgacgatcgcgtccgcgagcctgaccggcctg
ccgaacaaccatcgcgacttcgacctgccgatcgatcgcatcctgcatacggattgcccg
cactactaccgtcatgcgctgccgggcgaatcggaggagcagttcgcgacgcgctgcgcc
gagtcgctcgagcaactgatcctgcgcgaagggcccgacacgatcgccgcgttctttgcc
gagccgatcatggcgtcgggcggcgtgatcgtcccgccggccacctatatggagaagatc
cagcgcgtgctgaagcggtacgacatcctgctcgtggccgacgaggtcatctgcggattc
ggtcgcaccggcaacatgttcggctcggaaaccttcggcatgcagccggacatgatcgtc
gtcgccaagcagctgtcggccggctacctgccgatctcggcgctgatggtcaacgatgcg
atctatcgcgcgctcgtggccgaaagcgagaagatcggcaccttcggccacggcttcacg
tacagcggccatccggtttgcgcggccgtcgcgctcgagacgctgcgtatctacgacgaa
gacggcgtgctcgaccacgtgcgcagcgtgatcccgcacttccagcagcgcgtggccgat
ctcgccgggcatccgctcgtgggcgaggcgcgcggggccgggctgctcgcggcggtcgaa
ctggtcgccgacaaggcgacgaaaacgccgttcccgccgtccgaaggcgtggcggcccat
gccggcgagcgggcgctcgcgtacggcgtgatcacgcgcgcgcttggcgatgcgttcaat
ttctgcccgccattgatcatcacgcacgacgaaatcgaccagttgttcgatgcgtcgaaa
cgggcgctcgacgacacgctcgcgtggcgccggtcgctggccgcccgctga

DBGET integrated database retrieval system