KEGG   Burkholderia contaminans: NL30_33230Help
Entry
NL30_33230        CDS       T03969                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bcon  Burkholderia contaminans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKM44777
UniProt: A0A0G3Z5D4
LinkDB All DBs
Position
3:536599..538059
Genome map
AA seq 486 aa AA seqDB search
MTKRTIDLKHPREFYIGGQWVAPSTAETFDVLDCATEEVVATVAKAASADMQRAITAARD
AFDNGPWPRMTPQERAVYLEKFAERLEALNDDFARIWSIETGIVYKIAQPRIGLFISGAF
RQYAAMASTFPFVEEHRSVTGNLGYRVYEPVGVVGEIIPWNGPAGLMAYKTAPALLAGCT
LVIKSSPEAPCSAYLFAEICEEIGLPPGVINVVTADRDVSEELVRHPGVDKITFTGSTGA
GRRIASIAGDRVARVTLELGGKSPAVILDDFDVEAAANILGPSYFGYNTGQICHSLTRVI
VPRAKHDAMVEALSNIARQIVVGDPFAPETTSGPLASARQRETVERFVAKGIEEGATLAA
GGKRPAGLQRGFFFEPTVFGNVDNRSTIAQDEIFGPVLSVIPADDEASAIRMANDTPFGL
NAAVFTNDSARALHVARQIRSGTVGHNGPRTDFSIGFGGFKQSGIGREGGVEGLTAFMES
KTIVMA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagagaacgatcgacctcaagcatccccgagagttctacatcggcgggcaatgg
gtggcaccgtccaccgccgaaacgttcgatgtgctcgactgcgcgacggaagaagtcgtg
gcgaccgtggcaaaagccgcgtcggccgacatgcagcgtgcaatcaccgcggcgcgtgac
gcattcgacaacggcccgtggccccgcatgacgccgcaggaacgcgcggtctatctcgag
aagttcgcggaacggctggaagcgctgaacgacgatttcgcgcgcatctggtcgatcgag
accgggatcgtgtacaagattgcccagccgcgtatcgggctgttcatcagcggcgcattt
cgccagtacgcggcaatggcgtcgaccttcccgttcgtcgaggagcaccggtcggttacc
ggcaatctcggctatcgcgtctacgagccggtcggcgtcgtcggggaaatcattccgtgg
aacggtcctgccgggttgatggcgtacaagaccgcgccggcgctgctcgcaggttgcaca
ctggtgatcaagtcgtcgcccgaagcgccctgctcggcctacctgttcgccgagatctgc
gaagaaatcggtttgccgcccggtgtgatcaatgtcgtgacggccgatcgggacgtatcc
gaggagctggttcgccatcccggcgtcgacaagatcacgttcacgggatcgacaggcgcc
ggccgccggatcgcttccattgccggcgatcgcgtcgcgcgcgtcacgctcgaactcggc
ggcaaatcgcccgccgtcatcctcgatgatttcgatgtcgaagctgcggcaaacatcctc
gggccgtcctatttcggctacaacaccgggcagatctgccacagcctgactcgtgtgatc
gttccgcgtgcgaaacacgacgcgatggtcgaagcgttatcgaacatcgcccgacagatc
gtggtcggcgatccgttcgcgccggagacgacctccggcccgctcgcgagcgcacggcag
cgagagaccgtcgagcggttcgtcgcgaagggcatcgaggaaggcgcaacgttggcagcc
ggcggcaaacgtccggccggattgcagcgcgggttcttcttcgagccgacggtattcggc
aacgtggacaaccgttcgacgatcgctcaggacgagatcttcggcccggtattgagcgtc
attccggccgacgacgaagccagcgcgatccggatggcgaacgacaccccgtttggcctg
aatgccgcggtgttcacgaacgatagcgcccgtgcgctgcacgtggcacgccagatccgc
tcggggacggtcggccacaatggcccgcgcacagatttttcgatcggcttcggcggattc
aagcagtccggcatcgggcgtgaaggcggcgtcgaagggctgaccgcgttcatggaatcg
aagaccatcgtcatggcttga

DBGET integrated database retrieval system