KEGG   Burkholderia contaminans: NL30_35025
Entry
NL30_35025        CDS       T03969                                 

Definition
(GenBank) dehydratase
  KO
K17865  3-hydroxybutyryl-CoA dehydratase [EC:4.2.1.55]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00630  Glyoxylate and dicarboxylate metabolism
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
bcon01120  Microbial metabolism in diverse environments
bcon01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NL30_35025
   00650 Butanoate metabolism
    NL30_35025
Enzymes [BR:bcon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.55  3-hydroxybutyryl-CoA dehydratase
     NL30_35025
SSDB
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N 4HBT
Other DBs
NCBI-ProteinID: AKM45093
LinkDB
Position
3:complement(986322..986792)
AA seq 156 aa
MNDEGGYDLEDLMPGMSACFSKTLSEHDVRLFASATGDRNPMHLDETYAQRTFFGGRIAH
GMLSASVISAAIATHLPGPGSIYLSQDLQFRRPVRLGETVCATVTVKEILASRRRVVLET
RCEVDGLVVVEGTAVVMPTNAAARRKEAARVQDQEA
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaacgatgaaggcggatacgatctcgaggatctcatgcccggcatgagcgcgtgcttt
tcgaaaaccctttccgagcacgacgtgcggctgttcgcgagcgcgaccggcgaccggaac
cccatgcatctcgacgagacctatgcgcagcggacgtttttcggcggccgcatcgcgcac
ggcatgttgtccgcctcggtgatatcggcggcgatcgcgacgcatctgccagggccaggc
tcgatctacctgtcgcaggatctgcaattccgccgcccggtcaggctgggcgaaacggtt
tgcgcgaccgtaacggtcaaagagattctcgcgagccggcgccgggtcgtgctggaaacc
cgctgcgaagtcgacggcctcgtcgtcgtggaaggcacggcggtggtgatgcccacgaat
gcggcggcgcgccggaaagaagcggcgcgcgtgcaggatcaggaggcttga

DBGET integrated database retrieval system