KEGG   Bifidobacterium coryneforme: BCOR_0083Help
Entry
BCOR_0083         CDS       T03236                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcor  Bifidobacterium coryneforme
Pathway
bcor00620  Pyruvate metabolism
bcor00680  Methane metabolism
bcor01100  Metabolic pathways
bcor01120  Microbial metabolism in diverse environments
bcor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCOR_0083
  09102 Energy metabolism
   00680 Methane metabolism
    BCOR_0083
Enzymes [BR:bcor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BCOR_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AII74106
UniProt: A0A076JHZ3
LinkDB All DBs
Position
complement(67705..70464)
Genome map
AA seq 919 aa AA seqDB search
MTDSNQQITAADATLVASGTGTKGPEERDLPQSLGEDMALCLRLLRDVLGEFDKELLNRF
DSLREDVVAASAEHFNRHPSDPLPDEDGLAKAVALIDDTSIQDSQLLARALTTYFHLANL
CEENYRVRVLHEREGKIDLGVKGTDPINEMTSAYSQLLQEMGPAKASELLEKLEFHPVFT
AHPTEARRKAVEGKIRRIANLLAVRRGLGGSERVENERLLHNEIDALFRTSPIATKKPTP
VEESNTILDIFDATLFQTIPRVYRRFDDWMLGKKAGTVKPVCPAFFHPGSWIGSDRDGNP
NVTAKVSRKVARKFSDHVLKALQEATSTVGRNMTMEATTTPPSSELRSLWSHQKEMSERL
TDRAEVVSHRELHRAVVLVIADRLTATIKRDADLMYRSCDDFIADLKIVQDSLAAAGAVR
QAYGPLQDLIWQAQTFGFHMVEMEFRQHSLVHARALEDIREHGLHGERGELQPMTHEVLD
TFRALGAIQKRNGQKAARRYIISFTKSAQNVKDVYELNRLAFEHAEDVPVIDVIPLFEQL
EDLQNSVDVLEEIIKIPEVQARLKKTGNKMEVMLGYSDSSKDAGPVSATLALHSAQERIA
KWAQSHDIDVTLFHGRGGAVGRGGGPANRAVLAQPVGSVNCRFKLTEQGEVIFARYGNPV
LAIRHIESVAAATLLQSAPSVEERNTTMTEKYSDMAAKLDDSAHRRFLDLLHTPDFAPWF
SIVTPLNEIGLLPIGSRPAKRGLGAKSLDDLRTIPWVFSWAQARINLAAWYGLGTACEEF
NDLDTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLSLGDRDDLSQKVLSEMELTRK
WVLQIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVRALRTLRRRNDKEELSKSQQADF
IYLILCTVSGVAAGLQNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagtaatcagcaaatcacggcggcggatgcgaccctggttgcgtccggtacc
ggcacaaaaggcccggaggagcgcgatcttccccaatcactgggtgaggatatggcattg
tgcctgcgactgcttcgggatgttctgggggaattcgacaaggaactgctcaaccggttc
gactcgctgcgcgaagatgtggtggcggccagtgccgagcatttcaacagacacccctcc
gaccccctccccgacgaggacggtctggccaaggcggtcgccctgattgacgacacatcc
atacaggactcgcaactcctggcccgggctctgactacatacttccacctggccaacctc
tgtgaggagaactaccgggtgcgcgtcctgcatgagcgcgaaggaaagatcgacctgggt
gtcaagggcaccgaccccatcaacgaaatgaccagcgcctacagccaactccttcaggag
atgggtccggccaaggcctcggaactgctggaaaaactggagttccatccggtattcacc
gcccatcccaccgaggcgcgacgtaaggccgtcgagggcaagatacgccgcatcgccaac
ctgctggccgttcgccgtggactgggcggttccgagcgggtggaaaacgagcgtctgctc
cacaacgagatcgacgccctcttccgcacctcccccatcgcaaccaagaagccgacgccc
gtggaggaatccaacaccatcctcgacatcttcgatgccaccctcttccagaccatcccc
agggtctaccgcaggttcgacgactggatgttgggcaagaaggccggtacggtcaagccc
gtctgccccgccttcttccaccccggcagctggataggctccgacagggacggtaatccg
aacgtcaccgccaaggtctcgcgcaaggtggcccgcaagttctccgaccacgtgctcaag
gccctccaggaggcgacctccaccgtcggccgcaacatgaccatggaagcgactaccacc
ccgcccagcagcgaactgcgaagcctgtggagccaccagaaggaaatgagcgagcgcctg
accgaccgcgccgaggtcgtctcccacagggagttgcaccgggccgtggtcctggtcatc
gccgacaggctcaccgccaccatcaagcgtgacgccgacctgatgtaccgcagctgcgac
gatttcatcgccgacctgaagattgtccaggactccctggccgcagccggggccgtccgc
caggcctacggccccctccaggacctgatatggcaggcccagaccttcggtttccacatg
gtcgagatggagttccgtcagcactcactggtccacgcccgcgccctggaggacatccgc
gaacacggcctgcacggcgagcgcggcgaattgcagcccatgacccacgaggtgctcgac
accttccgtgccctgggtgccattcagaagcgcaacgggcagaaggcggcccgccgctac
atcatctccttcaccaagtcggcccagaacgtcaaggacgtctacgagctgaaccgtctg
gccttcgagcatgccgaggacgttcccgtcatcgacgtgatccccctgttcgagcagctg
gaggatctgcagaattcggtggatgtgttggaggagatcatcaagatccccgaggtccag
gcccgcctcaagaaaaccggcaacaagatggaggtcatgctgggatactccgactcctcc
aaggatgccggacccgtatcggccaccctggccctgcactccgcccaggagcgcatcgcc
aagtgggcccagagccatgacatcgacgtgaccctcttccacggccgcggcggcgccgtg
ggtcgcggtggcggcccggccaacagggcggtcctggcacagccggtgggctccgtgaac
tgccgcttcaagctgactgaacagggcgaggtgattttcgcccgctacggcaacccggtt
ctggccatccgccacatcgagtccgttgccgcagccaccctgctccagtcggcccccagc
gtcgaagagcgcaatacgaccatgacggagaagtactctgacatggccgccaagctggac
gattccgcccaccggcgcttcctggacctcctccacacccccgacttcgctccctggttc
tccatcgtgacgcctctgaacgaaatcggcctcctccccattggttcccgccccgccaag
cgtggtctgggagccaagtccctggatgatttgcggaccataccctgggtcttctcctgg
gcacaggcccgcatcaacctggccgcctggtacggcctgggaacggcctgcgaggagttc
aatgacctggataccctgcgccaggcctacgaggaatggcccctcttcagcaccttcatc
gacaacatcgaaatgagcctggccaagaccgacgagcgcatcgccaagatgtacctgtcc
ctgggtgatcgtgacgatctgagtcagaaggtcctttcggagatggagctgacccgcaag
tgggttctgcaaatcgtcggcgacgagtggcccctgcagcatcgccacgtgctgggccag
gccatccgtatccgctctccctacgtggatgccctatcggtcacccaggtacgcgccctg
cgaaccctgcggcggcgcaacgacaaggaggagctcagcaagagccagcaggcggacttc
atctacctgattctctgcaccgtttcgggagtcgccgccggcctccagaacactggctga

DBGET integrated database retrieval system