KEGG   Bifidobacterium coryneforme: BCOR_0261Help
Entry
BCOR_0261         CDS       T03236                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcor  Bifidobacterium coryneforme
Pathway
bcor00473  D-Alanine metabolism
bcor00550  Peptidoglycan biosynthesis
bcor01100  Metabolic pathways
bcor01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCOR_0261
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCOR_0261
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BCOR_0261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcor01011]
    BCOR_0261
Enzymes [BR:bcor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCOR_0261
Peptidoglycan biosynthesis and degradation proteins [BR:bcor01011]
 Precursor biosynthesis
  Amino acid ligase
   BCOR_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AII74281
UniProt: A0A076JIF7
LinkDB All DBs
Position
334761..335927
Genome map
AA seq 388 aa AA seqDB search
MMARKRVVVLYGGRADEHSISCVSAAGVLNAIDTDRYEPIPVGITKDGRWIVGGEDPRRW
SLDDTQLPTVQVTEGSCPVILDMARGGDGFMVGDHDDLVSGPDSLKTDSPQASGSLEPLG
HVDAVFPVLHGPYGEDGTVQGLLEMMGVPYVGCGVFASAACMDKHYTKILLSQAGIPVAP
GITIDARDRLSGVDLKAAVEEAGLHYPLFVKPSRAGSSFGVVKVEETGADALAAAVDEAS
GHDWRILIEEGVDGREIECAVLAPDREGEPRTAWPGEVVLDRTDQDEAFYDFDSKYVDSS
ASHVEVPADLPDETLSRIRALASRAFKAVDATGLSRVDCFVTAKGGIIVNEINTLPGFTP
ISMYAKAWEASGVTYTDLITELIEGVSA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatggccaggaaacgtgttgtcgtgctgtatggcggtcgtgccgacgagcactccata
tcctgtgtatcggcggccggtgtgctcaacgccatcgataccgaccgatatgagcccatt
ccggtcggaatcaccaaggacggtcgttggatcgtaggcggcgaggatcccaggcggtgg
agcctggacgacacccaattgcccaccgtgcaggtcaccgagggcagttgtccggtcatt
ctcgacatggcccgtggcggggatgggttcatggtcggtgatcatgacgacctggtttcc
ggtcccgacagcctcaaaacggactccccgcaggcctccggctctctggaacctctgggg
catgtggatgcggtctttccggtgctccacggcccgtatggcgaggacggcactgtacag
gggctgctcgaaatgatgggtgtgccctatgtgggatgtggggtcttcgcctctgccgcc
tgcatggacaagcactatacgaagattcttctcagccaggccggtattcccgtggcaccg
ggaatcaccatcgatgcccgcgaccgcctgtccggtgttgatctgaaggctgctgtggaa
gaggctgggctgcattatccgcttttcgtcaagccctcccgcgccgggtcgagcttcggt
gtggtcaaggtggaggagaccggtgccgatgccctggccgctgccgtcgatgaggcatcc
gggcatgactggcggatcctgattgaagagggtgtggacggccgtgaaatcgagtgtgcc
gtgctcgctcccgaccgcgaaggtgaaccccgcaccgcatggcccggcgaggttgtgctg
gacaggacggaccaggatgaggccttctacgacttcgacagcaagtatgtggactcctcg
gcctctcacgtggaggtccccgccgacctgcccgacgagaccctgagcaggatacgtgcc
cttgcctccagggcattcaaggccgtagacgctaccggtctgagccgtgtcgactgcttt
gtcaccgccaagggtggaatcatcgtcaacgaaatcaacaccctgcccggctttacgccc
atatcgatgtacgccaaggcctgggaggccagcggtgtcacctacaccgacctgattacc
gagctgatcgagggtgtatcagcctga

DBGET integrated database retrieval system