KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_426Help
Entry
BLBCPU_426        CDS       T01660                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
bcp00564  Glycerophospholipid metabolism
bcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLBCPU_426 (glpD)
Enzymes [BR:bcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BLBCPU_426 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 GIDA Pyr_redox_3 NAD_binding_8 HI0933_like Pyr_redox_2 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEU09467
UniProt: G8LQP9
LinkDB All DBs
Position
433915..435513
Genome map
AA seq 532 aa AA seqDB search
MKGFLNRDRFLRILENINIWDIIIVGGGATGLGIALDSASRGFKTLLLEQNDFSKGTSSR
STKLIHGGIRYLAQGNIKLVYEALQERGYLLKNAPHLVKKKRFIIPIFNWKMGILYWTGL
KIYEWLSGSLSFGNSQFLSKNEILKMFPEIRSNNLKGGILYYDGQFDDARLAIDLAQTCV
QQGGVLLNYFKVKNLIKKIENKIIGVIAYDLETKKKYSIYSKIVINATGVFSDTILKMDD
STSTILIKPSQGTHIVLKKSFFSSSDAIVIPKTSDGRILFSIPWYDHVLVGTTDTFLEKS
VLEPKPLEKEIDFILQTFNQYFLYNPNKKDILSAFSGLRPLFVPPNLSYSSTKDISRSHK
LMMSPSGLITIIGGKWTTYRKMAEETVNKAIEIGKLKKVSSITKNLKIFGYRTDFYSCKN
YNNWGDKYGEEEIHIQKLIEENPLWGDPLIYQYPYHCTKAEVIWMVRYEMARTIEDVLAR
RFRLLFLNAKIAIDIAPIIASLMAKELYRDKEWEESQIASFKELAMQYYYPF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttttttaaatagagatagatttttaagaattttagaaaatataaatatttgg
gatattattattgttggaggaggagcaacaggattaggaatagcattagattcagcttct
agaggatttaaaactttacttttagaacaaaatgatttttctaaaggaacttctagtcgt
agtacgaaattgatacacggtggaataagatatttagctcaaggaaatataaaattagtt
tatgaagctttgcaagagagggggtatttgttaaaaaatgctcctcatttagtgaaaaaa
aaacgatttattattcctatttttaattggaaaatggggattttgtattggactggttta
aaaatttatgaatggttatctggatccttgagttttggaaattctcaatttttatctaaa
aatgaaatactaaaaatgtttcctgaaattagatcaaataatttaaaaggagggatttta
tattatgatggacaatttgatgatgctcgtttagctattgatttagcacaaacttgtgtt
caacaaggtggagtattattaaattattttaaagtgaaaaatcttattaaaaaaatagaa
aataaaataattggagtaatagcttatgatcttgaaactaaaaaaaaatattctatttat
tcaaaaatagtgattaatgcaactggagttttttccgatactattttaaaaatggatgat
tccacatctactattttgataaagcctagtcaaggaacgcatattgtattaaaaaaatct
ttttttagtagttcagatgctatagtaattccaaaaacttcggatggaagaattctattt
agtataccatggtatgatcatgttttagtaggaactacagatacatttttggaaaaaagt
gttcttgaacccaaacctttagaaaaagaaatagattttattttacaaacttttaatcaa
tattttttatataatccgaataaaaaagacattttaagtgctttttctggattacgtcct
cttttcgtacctcctaatttatcttattcttctactaaagacatttctagatctcataaa
ttaatgatgagtccttcaggtttaataactattataggagggaaatggactacatataga
aaaatggcagaagaaaccgtaaataaagctattgaaattggaaaattaaagaaagtttct
tctataaccaaaaatcttaagatttttggttatagaactgatttttattcatgtaaaaat
tataataattggggggataaatatggagaagaagaaattcatattcaaaaattaattgag
gaaaatcctttatggggagatccattaatttatcaatatccttatcattgtacaaaagca
gaagttatatggatggtacgttatgaaatggctagaacaattgaagatgttttagcaaga
agatttcgtttattatttttaaatgctaaaatagcaatagatatagcaccaataatagca
tcattaatggcaaaagaactttatcgagataaagaatgggaagaatctcagatagcttct
tttaaagaattagccatgcaatattattatccattttga

DBGET integrated database retrieval system