KEGG   Bacillus cereus Q1: BCQ_1196Help
Entry
BCQ_1196          CDS       T00852                                 

Gene name
comK
Definition
(GenBank) competence transcription factor
  KO
K02250  competence protein ComK
Organism
bcq  Bacillus cereus Q1
Pathway
bcq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCQ_1196 (comK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bcq03000]
    BCQ_1196 (comK)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcq02044]
    BCQ_1196 (comK)
Transcription factors [BR:bcq03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BCQ_1196 (comK)
Secretion system [BR:bcq02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BCQ_1196 (comK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: ACM11626
UniProt: B9ITE4
LinkDB All DBs
Position
1185291..1185872
Genome map
AA seq 193 aa AA seqDB search
MESKVERYVENYVVNKNTMALLPVILSEKKIVTRVVEVQDSFFVFQKPLDIIERSCRKHG
SSFLGRKEGTKELTHITHKAPIAISPTDQLYFFPTYSYSRKECAWLSHFYIESNKELKDG
NLIIRFINGFAVKLEISKTSFENQQNRTAKLRTEYEDRRKKQGNPCFKEVDQRDESTLRP
AYERVYVVREEDV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtagaacgctacgtcgaaaactatgttgtaaataaaaatacaatggcc
ttacttcctgtaattctcagtgaaaagaaaattgttacgcgagttgttgaagtgcaagac
tcttttttcgtatttcaaaaacctctagatattatagaaagaagttgtcgcaagcatggt
tctagtttcttaggcagaaaagaaggaacgaaagagttaactcacattacacataaagca
ccaattgcaattagtccgaccgatcaactttattttttccctacctattcgtattctaga
aaagagtgcgcgtggttatctcatttttatattgaaagcaataaagaattaaaagatgga
aaccttattatccgatttataaatggttttgctgtgaagttagagatatcgaaaactagt
tttgaaaatcaacaaaatcgtactgcgaaattgcgaacggagtatgaagatcgtaggaaa
aaacaagggaatccttgctttaaagaggttgatcaaagggatgaatcaacattaagacca
gcttatgagagagtgtatgttgttagagaagaggatgtgtga

DBGET integrated database retrieval system