KEGG   Bacillus cereus Q1: BCQ_2484Help
Entry
BCQ_2484          CDS       T00852                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00473  D-Alanine metabolism
bcq00550  Peptidoglycan biosynthesis
bcq01100  Metabolic pathways
bcq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCQ_2484 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCQ_2484 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BCQ_2484 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcq01011]
    BCQ_2484 (ddlB)
Enzymes [BR:bcq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCQ_2484 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bcq01011]
 Precursor biosynthesis
  Amino acid ligase
   BCQ_2484 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACM12912
UniProt: B9J1X6
LinkDB All DBs
Position
2447827..2448741
Genome map
AA seq 304 aa AA seqDB search
MRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLAL
HGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNMSKKILRYEGIETPDWIELTKMED
LDFDELDKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGDEI
TCSIFDGKQLPIISIRHAAEFFDYNAKYDDAGTIEEVIELPAELKERVNKASLACYKALK
CSVYARVDMMVKDGIPYVMEINTLPGMTQASLLPKSAAAAGIEYSKLLDMIIETSLRVRK
DEGF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttattatgggaggagtatcctctgaaaaacaagtatccattatgact
ggaaatgaaatgattgcaaatttagataaaaataaatatgaaattgtcccaattacatta
aatgaaaaaatggatttaatcgaaaaagcgaaagacattgattttgcgctgctcgcatta
cacggaaaatacggagaagatggaactgttcaaggaacgcttgaaagtttaggtattcct
tatagcggaagtaatatgttatctagcggtatatgtatggacaaaaacatgtcaaaaaag
attttacgttatgaaggaatagaaacaccagattggattgaacttacaaaaatggaggat
ttggattttgatgagttagataagttaggatttccattagtggtaaaaccaaactctggt
ggttcaagtgttggggtaaagattgtctatgataaagacgaattaatttcaatgctggaa
actgtgttcgaatgggattctgaagtagtaatagaaaagtatattaaaggtgatgagatt
acatgttccatttttgatggaaaacagttacctatcatttcaattcgacatgcagctgag
ttctttgattacaatgcgaaatatgatgatgcaggtactattgaagaagttatcgaactt
ccagctgaacttaaggaacgtgtaaacaaagcgtcactggcttgctataaagcattaaaa
tgcagcgtttatgcaagggtggatatgatggtgaaggatggtattccatatgtaatggag
attaatacattaccagggatgacgcaagcgagtttactgccaaaaagtgcagctgcagcg
ggaattgaatatagtaaactattagatatgattattgaaacttcattaagagtaagaaaa
gacgaaggattttaa

DBGET integrated database retrieval system