KEGG   Bacillus cereus Q1: BCQ_3647Help
Entry
BCQ_3647          CDS       T00852                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bcq  Bacillus cereus Q1
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bcq01001]
    BCQ_3647
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BCQ_3647
Protein kinases [BR:bcq01001]
 Serine/threonine kinases: Other
  Bacterial family
   BCQ_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH RIO1 Haspin_kinase ETRAMP Kdo Kinase-like
Motif
Other DBs
NCBI-ProteinID: ACM14075
UniProt: B9IVF1
LinkDB All DBs
Position
complement(3609414..3611324)
Genome map
AA seq 636 aa AA seqDB search
MANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREAQSVTTLSHPNIVNMYDVGEED
GIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTSAMAHAHHFEIVHRDIKPHNIL
IRADGVIKVTDFGIATATSATTITHTNSVLGSVHYLSPEQARGGIANKQSDIYSLGIVMF
ELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNESIPQSVENIILKATAKDPFHRYQSAN
AMKRDIETALYPERINEQPFYIPEDMEATKAIPVIQQEQLFENVTDETIVLQGSKVDEQA
RKEDEDLNKKKKRSNKWLKVLITTFLLLAIGITLALTVIPGFFIPKDVKVPDVAGMKYTT
AVNTLVEKGFEVTEPNIVYTDDVETGDVIKTDPVAGRVVKENSKITIYQSGGKKKSKMID
FTGKDLESIRTELEEKYKQVTVYYIEDDRPKGAIVEQFPTSDQMVVEAEQELKIWVSKGP
YQIRPGDFSRWTENSATGYLNERKLTPDIKREYSDTVDKGLVISQSPKPGTPLKEGDKVT
IVISDGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEIYKEDMQQKMDRPIETRTISES
ATISLEFVIQEGTKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtgtatttagctcatgatgatatactaggccgagatgtagcggtgaaaata
ttaagactcgactattcaaataacgaagagtttattaaacgtttccatcgagaagcgcag
tctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagaagat
ggtatatattatcttgtaatggagtatgtaccaggacaaacattgaagcaatacataatt
gagcgaggaatgttaccgataggagaagctcttgatattatggagcagttaacatccgcc
atggcacacgcccatcattttgaaattgtgcaccgcgatattaaaccgcacaatatttta
attcgagctgatggagtaataaaagtaacagattttggaattgcgacagctacaagtgca
acaacaattacacatacaaattcagtactcggttcggtgcattatttatcaccagaacaa
gcacgtggcgggatagcaaataaacaatcagatatttattccctagggattgttatgttt
gagttgttaacaggaagacaaccattttctggagaatctgctgttgctatagctttaaaa
catttacaaagtgaaattccgtctccaaaaagatggaatgaaagtattccgcaaagtgtc
gaaaatattatattaaaggcaactgcgaaagatccgtttcatcgatatcaatctgctaat
gcgatgaaacgagatattgaaactgcgctatatccagagaggataaatgagcagccattt
tacataccggaagatatggaagcgacaaaagcgattccggttattcaacaggaacaatta
ttcgaaaatgtaactgatgaaacaattgttttacaaggaagtaaagtggatgaacaggca
agaaaagaagatgaggatttaaataagaagaaaaaacgaagtaataaatggctcaaagtt
ttaattacaacatttttacttttagcgatcggaataacgttagcccttactgttattcca
ggattctttattccaaaagatgtaaaagtccctgatgtggctggtatgaaatatacgacc
gcagtaaatacattagttgaaaagggttttgaggttacggaacctaatattgtatataca
gatgatgttgaaaccggtgatgttataaaaacagaccctgtggcaggaagagtcgtgaaa
gaaaactctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatgattgat
ttcacaggaaaagatttagagagtataagaacagagttagaagagaaatataaacaagtt
acagtatattatattgaagatgataggccaaaaggtgcaatcgtagagcaatttccgacg
tctgaccaaatggtggtagaggccgagcaagaactgaaaatctgggtgagtaaaggtcct
tatcaaattagaccgggtgatttttcaaggtggactgaaaatagtgcaactggttatctg
aatgagagaaaactaactccagatataaaacgagagtattctgatactgttgataaagga
cttgtaatttcgcaatctccaaaaccaggaacgccgttaaaagaaggagataaagtgacg
attgttatttcagatggtcctaagccgaaagtaacgaaaacagtgaaagtggataatatt
tctattccgtatgagtcttctataataggtgagaaaaaaccgcaaacgatagaaatttat
aaagaagatatgcaacaaaaaatggatagaccaattgaaactagaacaatttcagagtcg
gcaactatttcattagaatttgtaattcaagaaggtacaaaaggacattataaaattgta
cgagatggtgtaacgattattgacaaagaagtaccatacccaactcaataa

DBGET integrated database retrieval system