KEGG   Bacillus cereus Q1: BCQ_4324Help
Entry
BCQ_4324          CDS       T00852                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00020  Citrate cycle (TCA cycle)
bcq00190  Oxidative phosphorylation
bcq00650  Butanoate metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
Module
bcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCQ_4324 (sdhB)
   00650 Butanoate metabolism
    BCQ_4324 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCQ_4324 (sdhB)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCQ_4324 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BCQ_4324 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ACM14750
UniProt: B9J020
LinkDB All DBs
Position
complement(4235818..4236579)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNKTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacggaccagatgcgcaagcg
tttgaccaagagtttgaaattccgtatcgtccgaatatgaatattatttcggcgcttatg
gaaattcgtcgtaatcctgttgattcaaaaggaaacaaaacaactccgattgcatgggat
atgaactgtttagaggaagtatgtggtgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacagcgcttatcgatcaattagaacaaccaattcgcttaaaaccgatgaag
acattcccggttgttcgtgacttacaagttgaccgtagtcgcatgtttaatgctctaaaa
cgtgttaaagcttggattccaattgatggtacgtatgacttaggaccaggaccaaggatg
ccagagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaatagtaaatcggactttattggaccagcaccgttatca
caagctcgtttatttaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggtgatggaggacttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccaaagggtattccattaacaacttcaattgcggcgttaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgacaataactattaa

DBGET integrated database retrieval system