KEGG   Bacillus cereus Q1: BCQ_4325Help
Entry
BCQ_4325          CDS       T00852                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00020  Citrate cycle (TCA cycle)
bcq00190  Oxidative phosphorylation
bcq00650  Butanoate metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
Module
bcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCQ_4325 (sdhA)
   00650 Butanoate metabolism
    BCQ_4325 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCQ_4325 (sdhA)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCQ_4325 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BCQ_4325 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACM14751
UniProt: B9J021
LinkDB All DBs
Position
complement(4236572..4238365)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVIDDEGVCRGIVAQDLQT
MEIRSFRADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTSIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDISLIKPRKRDYSSKHDVAAKSEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcggaagcaggagtaaatgttgaactgttctctttagtaccagtaaaacgttcgcat
tctgtatgtgcccaaggtggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaactcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttattgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattagaagtttccgagctgatgccgtgattatggcaacagggggccctggtatc
atcttcggaaaatcaacaaactccattatcaatacaggtacagcagcttctgctgtatat
caacaaggcgcatattatgcaaacggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtctgatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtatttcttagaagaaaaatatccggcttacggaaac
cttgtacctcgtgatatcgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacttagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaaatttacaggtgatgatcctcgt
aaactaccaatgaaaatcttcccagctgttcactattcaatgggcgggctatgggttgat
tataagcagatgacaagcattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgtcttggcgcgaactcactattatcagcaatttacggtggtatggta
gcaggaccaaatgcaattgaatatatgaaaggtctttctaaatcatcagatgctgtttca
tctactgtgtatgaacaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
ctcgatggtaacgaaaatgcgtatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaaattattagaaacagatgcaaaaattgaagag
ttaatggctcgctacaaacgtattaacattaacgatacagcgagatggagcaaccaaggt
gcttcatttacacgccaacttgcaaatatgtttgaattagcacgtgttattacaattggt
gcatataaccgtaatgagagccgtggggcgcattacaaacctgaattcccaaatcgtgat
gatgcaaacttcttaaaaactacgatggcgaaatttgaaggagaaggaaatgcaccggca
ttccattacgaagacgtggatatttcattaattaaaccacgtaaacgtgattattcttca
aaacacgatgtagctgctaagagtgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system