KEGG   Bacillus cereus Q1: BCQ_4397Help
Entry
BCQ_4397          CDS       T00852                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00020  Citrate cycle (TCA cycle)
bcq00480  Glutathione metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
bcq01210  2-Oxocarboxylic acid metabolism
bcq01230  Biosynthesis of amino acids
Module
bcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCQ_4397 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCQ_4397 (citC)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCQ_4397 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACM14823
UniProt: B9J093
LinkDB All DBs
Position
complement(4311033..4312340)
Genome map
AA seq 435 aa AA seqDB search
MGVITLTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKK
IVWKEVLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDL
YVCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMG
VNKIRFPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNW
GYEVAEQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLD
KVNPSSVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFA
NELIKNMDVAIIKNA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggttatcacattgacgacaggtgaaaaaattactgtaactaatggtgttatgaat
gtaccaaacaatccgattattccatttatcgaaggagatggaattggtcctgatatttgg
gcagctgcatctcgtgtactagaagcagcagttgaaaaagcttatgatggtgagaagaaa
atcgtttggaaagaagtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggtta
ccagaagaaactttaaatttaattcgtgaatatttaatcgcgattaaaggtccacttaca
actccagttggcggtggtattcgttctctaaacgtagcacttcgtcaagaattagattta
tatgtatgtctacgtccagttcgttattttgaaggtgttccttcacctgtaaaacgtccg
gaagatactgatatggttattttccgtgaaaatacagaagacatttatgctggaattgaa
tatgcgcaaggatctccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggt
gttaataaaatccgcttcccagaaacatctggtattggtattaaaccaatctcagaagaa
gggacaaagcgtcttgttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttct
gttacattagttcataaaggaaacattatgaaatttacagaaggtgctttcaaaaactgg
ggttacgaagtagcggaacaagaattcggcgacaaagtatttacttgggctgaatatgat
cgtatcgttgagaaagatggtaaagatgcagcgaataaagcgatggcagacgctgaagtg
gctggaaaaatcatcgtaaaagattctattgcagacatcttcttacaacaaattttaact
cgtccacgtgagttcgatgttgttgcaacaatgaacttaaacggtgactacatctctgat
gcacttgctgcacaagtaggtggaattggtattgcacctggtgcaaacattaactatgta
actggacatgctatctttgaagctacgcacggtacagctccaaaatatgcaggtttagat
aaagtaaacccatcttcagttcttctttctggtgtattattattagaacacttaggatgg
aacgaagctgcgaaattagtaactgcttcagttgagaagacaattgcttcaaaagtagta
acttatgatttcgcacgcttaatggaaggtgcaacagaagtgaaatgttctgagtttgct
aatgaacttattaaaaacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system