KEGG   Bacillus cereus Q1: BCQ_4977Help
Entry
BCQ_4977          CDS       T00852                                 

Gene name
mutT
Definition
(GenBank) MutT/Nudix family protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bcq  Bacillus cereus Q1
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcq03400]
    BCQ_4977 (mutT)
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BCQ_4977 (mutT)
DNA repair and recombination proteins [BR:bcq03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BCQ_4977 (mutT)
 Prokaryotic Type
    BCQ_4977 (mutT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ACM15377
UniProt: B9J4R0
LinkDB All DBs
Position
complement(4839700..4840158)
Genome map
AA seq 152 aa AA seqDB search
MQRVTNCVLIRDNEVLLLQKPRRNWWVAPGGKMERGETVRDSVVREYREETGIYLKNPAL
KGVFTFVIQEGDKVVSEWMMFSFLATDFAGENKLESEEGIIGWHTFDKIDDLAMAPGDYH
IIDYLIKGNGIIYGTFVYTPDFELLSYRLDPS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagtgacaaactgtgtgttaattagagataatgaagtactcttactccaaaaa
cctcgccggaattggtgggttgcaccaggcgggaaaatggagcgtggtgagactgtaaga
gattccgttgttcgcgagtatcgtgaagaaacaggtatttatttaaagaacccagcgtta
aagggggtcttcacctttgtcatccaagaaggtgataaagttgtttctgaatggatgatg
ttctcctttttagcgacagattttgcaggagaaaacaaactagagagcgaagaaggcatc
attggttggcatacatttgataaaattgatgatttagcaatggcaccaggagattatcac
attattgattatttaattaaaggaaatggcataatctacggtacatttgtatatacccca
gattttgagttgctttcatatcgattagatccgagttaa

DBGET integrated database retrieval system