KEGG   Bacillus cereus AH187: BCAH187_A1377Help
Entry
BCAH187_A1377     CDS       T00799                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00061  Fatty acid biosynthesis
bcr00780  Biotin metabolism
bcr01100  Metabolic pathways
bcr01130  Biosynthesis of antibiotics
bcr01212  Fatty acid metabolism
Module
bcr_M00083  Fatty acid biosynthesis, elongation
bcr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BCAH187_A1377 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BCAH187_A1377 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BCAH187_A1377 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcr01004]
    BCAH187_A1377 (fabI)
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BCAH187_A1377 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BCAH187_A1377 (fabI)
Lipid biosynthesis proteins [BR:bcr01004]
 Fatty acid synthase
  Component type
   BCAH187_A1377 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ACJ77860
UniProt: B7I0D1
LinkDB All DBs
Structure
PDB: 

Position
1293585..1294355
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTQEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgttgttatgggcgttgcgaaccaaagaagtatt
gcatggggaattgctcgctctttgcataatgcaggtgcaaaattaatcttcacatatgca
ggagaacgtttagagagaaacgttcgtgaattagcggatacattagaaggacaagagtca
cttgtattaccttgtgatgtaacaaatgatgaagaacttacagcttgctttgaaacaatc
aaacaagaagttggtacaattcacggtgtagcacattgtattgcttttgcaaatcgtgac
gacttaaaaggtgaatttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agtgcattctccttaacagctgtagcaagagaagcgaagaaagtaatgacagaaggcgga
aatattttaacgttaacatatcttggcggcgagcgcgttgtgaaaaactataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtgaagtatttagctaacgatttaggtcaa
catggcattcgtgttaacgctatttctgcaggtccaattcgtacgttatctgcaaaaggt
gtaggcgactttaactcaatcttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaacgcaagaagaagttggagatacagcagtattcttattcagtgatttagcacgcggc
gtaacaggagaaaacattcacgttgattcagggtatcatatcctaggttaa

DBGET integrated database retrieval system