KEGG   Bacillus cereus AH187: BCAH187_A1476Help
Entry
BCAH187_A1476     CDS       T00799                                 

Definition
(GenBank) putative iron compound ABC transporter, iron compound-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
bcr  Bacillus cereus AH187
Pathway
bcr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCAH187_A1476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcr02000]
    BCAH187_A1476
Transporters [BR:bcr02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    BCAH187_A1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1 LysR_substrate
Motif
Other DBs
NCBI-ProteinID: ACJ81374
UniProt: B7I0M8
LinkDB All DBs
Position
1384076..1385152
Genome map
AA seq 358 aa AA seqDB search
MKKTIFKAVATGMVFSLLMGCGAKKEESAGAKVKDDKLSGSLTVYTAIEEELVPIYLDSF
KKKYPDVKLNIVRDSTGVITAKLLAEGKNTQADVVWGTAASSLLALDKKDMLKGYSPKGA
DRVLPQFKDDKQPEKWVGNTAFMTGIAINKEELKKKNLPMPESYEDLTKPEYKGTLVMPH
PASSGTGFLTVSAWLQIMGEDKGWDYMKKLHDNMATYTHSGSKPAKLAGAGEYPVGVSMV
YSALKEKQKGAPVEVVLPKEGLGWEVEANALIKKDNEKNEKLAQAFLDWAITDDVMKLYF
EKNGFATIKNDYKLPDGFPKDVTEKLYKKNDFKWAAENRDKILEKWEKEFGQKAEPKK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaacaatctttaaagctgtagcaactggaatggtattttcgttattaatgggg
tgtggtgcaaagaaagaagaaagtgctggggcaaaagtaaaagatgataaattatctgga
tcattaactgtttacacagcaattgaagaagaacttgtaccaatttatcttgattctttt
aaaaagaaatatccagatgtgaagctgaatattgttcgtgattcaactggagttattaca
gcaaaattgctagctgaagggaaaaatacacaagcagatgttgtatggggaactgcagct
tcaagtctattagctttagataaaaaagatatgttaaaaggatactctccaaaaggagcg
gatcgcgttttaccgcaatttaaagatgataaacaaccagaaaaatgggtaggaaatact
gcatttatgacggggattgctataaataaagaagaattaaagaagaaaaatttaccgatg
ccagaatcatacgaagacttaacgaaaccagagtataaaggaacgcttgttatgccacat
ccagcatcttctggaacaggatttttaacagtttctgcatggttacaaattatgggtgaa
gataaaggctgggattacatgaagaaacttcatgataatatggcaacttatactcattca
ggttcaaaaccagcgaaattagcgggggcgggtgaatatccagttggtgtatcgatggtt
tatagtgctttgaaagagaaacaaaaaggtgcaccagttgaagttgtattgccaaaagaa
ggattaggttgggaagtagaagcgaacgcacttattaaaaaagataatgaaaaaaatgaa
aaattagcgcaagcatttttagattgggcaattactgatgatgtaatgaagttatacttc
gagaaaaatggatttgcgacaattaaaaatgattataaacttccagacggattccctaaa
gatgtgacggaaaagttatacaaaaagaacgactttaagtgggcagcagaaaatcgtgac
aaaattttagaaaaatgggaaaaagagtttggccaaaaagcagaaccgaaaaagtaa

DBGET integrated database retrieval system