KEGG   Bacillus cereus AH187: BCAH187_A3910Help
Entry
BCAH187_A3910     CDS       T00799                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bcr  Bacillus cereus AH187
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bcr01001]
    BCAH187_A3910
Enzymes [BR:bcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BCAH187_A3910
Protein kinases [BR:bcr01001]
 Serine/threonine kinases: Other
  Bacterial family
   BCAH187_A3910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase ETRAMP Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ACJ82396
UniProt: B7HLJ5
LinkDB All DBs
Position
complement(3665454..3667427)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGVIKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNESIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPVIQQEQ
LFENVTDETIVLQGSKVDEQARKEDEDLNKKKKRSNKWLKVLITTFLLLAIGITLALTVI
PGFFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNIVYTDDVETGDVIKTDPVAGRVV
KENSKITIYQSGGKKKSKMIDFTGKDLESIRTELEEKYKQVTVYYIEDDRPKGAIVEQFP
TSDQMVVEAEQELKIWVSKGPYQIRPGDFSRWTENSATGYLNERKLTPDIKREYSDTVDK
GLVISQSPKPGTPLKEGDKVTIVISDGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEI
YKEDMQQKMDRPIETRTISESATISLEFVIQEGTKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctactgaaaatgattggtggcggt
ggaatggccaatgtgtatttagctcatgatgatatactaggccgagatgtagcggtgaaa
atattaagactcgactattcaaataacgaagagtttattaaacgtttccatcgagaagcg
cagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagaa
gatggtatatattatcttgtaatggagtatgtaccaggacaaacattgaagcaatacata
attgagcgaggaatgttaccgataggagaagctcttgatattatggagcagttaacatcc
gccatggcacacgcccatcattttgaaattgtgcaccgcgatattaaaccgcacaatatt
ttaattcgagctgatggagtaataaaagtaacagattttggaattgcgacagctacaagt
gcaacaacaattacacatacaaattcagtactcggttcggtgcattatttatcaccagaa
caagcacgtggcgggatagcaaataaacaatcagatatttattccctagggattgttatg
tttgagttgttaacaggaagacaaccattttctggagaatctgctgttgctatagcttta
aaacatttacaaagtgaaattccgtctccaaaaagatggaatgaaagtattccgcaaagt
gtcgaaaatattatattaaaggcaactgcgaaagatccgtttcatcgatatcaatctgct
aatgcgatgaaacgagatattgaaactgcgctatatccagagaggataaatgagcagcca
ttttacataccggaagatatggaagcgacaaaagcgattccggttattcaacaggaacaa
ttattcgaaaatgtaactgatgaaacaattgttttacaaggaagtaaagtggatgaacag
gcaagaaaagaagatgaggatttaaataagaagaaaaaacgaagtaataaatggctcaaa
gttttaattacaacatttttacttttagcgatcggaataacgttagcccttactgttatt
ccaggattctttattccaaaagatgtaaaagtccctgatgtggctggtatgaaatatacg
accgcagtaaatacattagttgaaaagggttttgaggttacggaacctaatattgtatat
acagatgatgttgaaaccggtgatgttataaaaacagaccctgtggcaggaagagtcgtg
aaagaaaactctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatgatt
gatttcacaggaaaagatttagagagtataagaacagagttagaagagaaatataaacaa
gttacagtatattatattgaagatgataggccaaaaggtgcaatcgtagagcaatttccg
acgtctgaccaaatggtggtagaggccgagcaagaactgaaaatctgggtgagtaaaggt
ccttatcaaattagaccgggtgatttttcaaggtggactgaaaatagtgcaactggttat
ctgaatgagagaaaactaactccagatataaaacgagagtattctgatactgttgataaa
ggacttgtaatttcgcaatctccaaaaccaggaacgccgttaaaagaaggagataaagtg
acgattgttatttcagatggtcctaagccgaaagtaacgaaaacagtgaaagtggataat
atttctattccgtatgagtcttctataataggtgagaaaaaaccgcaaacgatagaaatt
tataaagaagatatgcaacaaaaaatggatagaccaattgaaactagaacaatttcagag
tcggcaactatttcattagaatttgtaattcaagaaggtacaaaaggacattataaaatt
gtacgagatggtgtaacgattattgacaaagaagtaccatacccaactcaataa

DBGET integrated database retrieval system