KEGG   Bacillus cereus AH187: BCAH187_A3984Help
Entry
BCAH187_A3984     CDS       T00799                                 

Gene name
xhlB
Definition
(GenBank) holin, SPP1 family
Organism
bcr  Bacillus cereus AH187
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: ACJ79423
UniProt: B7HM52
LinkDB All DBs
Position
complement(3738189..3738419)
Genome map
AA seq 76 aa AA seqDB search
MKNFDAASISRYVVLVIAVINSVLNLVGYQTIDDKITNDLVAVITGAFTLYMAWKNNYLS
NKGLQQKDVLEKNNLH
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttgatgcagcttcaattagtcgttatgtcgtattagtaattgctgtgata
aatagtgtcttaaatcttgtgggataccaaacgattgatgacaaaattacaaacgattta
gtggcagtaattacaggagctttcactctatatatggcatggaagaataactatttaagc
aataaaggattacaacaaaaagatgtattagaaaaaaataacttacactaa

DBGET integrated database retrieval system