KEGG   Bacillus cereus AH187: BCAH187_A4719Help
Entry
BCAH187_A4719     CDS       T00799                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00020  Citrate cycle (TCA cycle)
bcr00480  Glutathione metabolism
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01200  Carbon metabolism
bcr01210  2-Oxocarboxylic acid metabolism
bcr01230  Biosynthesis of amino acids
Module
bcr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAH187_A4719 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCAH187_A4719 (citC)
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCAH187_A4719 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACJ81429
UniProt: B7HRN3
LinkDB All DBs
Position
complement(4377821..4379113)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccatttatcgaaggagatggaattggtcctgatatttgggcagctgcatctcgt
gtactagaagcagcagttgaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagaaacttta
aatttaattcgtgaatatttaatcgcgattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcacttcgtcaagaattagatttatatgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatttatgctggaattgaatatgcgcaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaaaccaatttcagaagaagggacaaagcgtctt
gttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttctgttacattagttcat
aaaggaaacattatgaaatttacagaaggtgctttcaaaaactggggttacgaagtagcg
gaacaagaattcggcgacaaagtatttacttgggctgaatatgatcgtatcgttgagaaa
gatggtaaagatgcagcgaataaagcgatggcagacgctgaagtggctggaaaaatcatc
gtaaaagattctattgcagacatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaacggtgactacatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtaactggacatgctatc
tttgaagctacgcacggtacagctccaaaatatgcaggtttagataaagtaaacccatct
tcagttcttctttctggtgtattattattagaacacttaggatggaacgaagctgcgaaa
ttagtaactgcttcagttgagaagacaattgcttcaaaagtagtaacttatgatttcgca
cgcttaatggaaggtgcaacagaagtgaaatgttctgagtttgctaatgaacttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system