KEGG   Brucella canis ATCC 23365: BCAN_A0579Help
Entry
BCAN_A0579        CDS       T00623                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bcs  Brucella canis ATCC 23365
Brite
Enzymes [BR:bcs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCAN_A0579 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABX61656
UniProt: A9M9J2
LinkDB All DBs
Position
I:559680..560279
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLAGKSLEEIVKES
FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA
GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLVNWDYVLEMYEKAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgcccgcccttccgtatgactatgatgcgcttgcgcctttcatgtcg
cgcgaaacgcttgaatatcatcacgacaagcatcatcaggcctatgtcaccaacggtaac
aagcttctcgaaggttccggcctggcaggcaagagcctcgaagaaatcgtcaaggaaagc
ttcggcaagaatcaggccctcttcaacaatgccggccagcactacaaccatatccatttc
tggaaatggatgaagaaggatggcggcggcaagaaactgccgggcaagctggaaaaggcc
tttgattccgatcttggcggttatgacaagttccgcgctgatttcatcgctgccggtgcc
ggccagttcggttcgggctgggcctggctttccgtcaaggacggcaagcttgaaatttcc
aagaccccgaacggtgaaaacccgctcgtgcacggtgcggcgccgatcctcggcgtggat
gtgtgggaacactcctattacatcgattaccgcaacgcgcgtccgaaatatctcgaagct
ttcgtcgatagcctcgtgaactgggattacgtgctggaaatgtacgaaaaggcggcataa

DBGET integrated database retrieval system