KEGG   Brucella canis ATCC 23365: BCAN_A0914Help
Entry
BCAN_A0914        CDS       T00623                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00970  Aminoacyl-tRNA biosynthesis
bcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCAN_A0914 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcs03029]
    BCAN_A0914 (gatB)
Enzymes [BR:bcs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCAN_A0914 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCAN_A0914 (gatB)
Mitochondrial biogenesis [BR:bcs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCAN_A0914 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABX61975
UniProt: A9MAS2
LinkDB All DBs
Position
I:871508..873010
Genome map
AA seq 500 aa AA seqDB search
MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD
AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS
KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV
NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR
DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN
EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG
GKANPQAVNELVKSKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtccattatcgatacgcgtacacctgaacccaaacgcttcatctctggtgcgaccggc
gattgggaagtcgtcatcggaatggaagtccatgcgcaggtcacgtcagaatcgaagctg
ttttccggcgcttccaccgcattcggtgccgagccgaactccaatgtctctctcgtggat
gcggccatgccgggcatgttgccggtcatcaatctggaatgcgtgaggcaggctgtgcgc
accggcatcggcttgaatgcgcagatcaatctgaagtcggtcttcgaccgcaaaaattat
ttctatcccgatttgccgcagggctaccagatttcgcagttcaagcagccgatcgtcggt
gagggcaagatcatgatttcggtcggcccggacaacaagggccagttcgaggacgtggag
atcggcattgagcgcctgcatcttgagcaggatgcgggtaaatccatgcacgaccagcac
ccgaccatgtcctatgtggacctgaaccgttcgggcgtggcgctgatggagatcgtatcc
aagccggatctgcgctcgtcggatgaagcgcgcgcttacctcaccaagctgcgcacgatt
gtccgctatcttggcacctgcgacggcaatatggatgaaggttccatgcgtgctgacgtc
aatgtttcggtgcgccgtccaggcggcgaattcggcacgcgttgcgagatcaagaacgtc
aactcgatccgctttgtcggccaggccatcgaatatgaagcgcgccgccagattgccatt
ctggaagatggcggcgtgattgatcaggaaacgcgcctgttcgatccggtgaaaggcgaa
acccgttccatgcgctccaaggaagaggcgcatgactatcgttatttccccgatccggac
ttgttgccgcttgaattcgatcaggccttcgtggatgcgctggcggccaaattgccggaa
ctgccggatgtgaaaaagcagcgccttgtcgaaacgcttggcatttccgtttatgacgcc
tcgatccttgtgacggagaaggccatagccgattattatgaggcggttgccgaggggcgc
gacggcaaggctgccgcaaactgggtcatcaacgatcttctgggcgcgctgaacaaggcg
ggcaaggatatcgaggaatcgccgattagccccgcccagcttggcgccatcatcgatctc
atcaaggaaggtacgatttccggtaagatcgcaaaggatcttttcgagatcgtctggaat
gagggtggcgatccgaagaagctcgttgaagagcgcggcatgaagcaggttacagatacc
ggcgcgattgaaaaggctgtcgatgacgtcattgccgccaacccggacaaggttgagcag
gccaaggcgaagccgacgctggctggctggtttgtcggtcaggtcatgaaggcgacgggc
ggcaaggccaacccgcaggccgtcaatgaactggtgaaatccaagctggggattgaggaa
taa

DBGET integrated database retrieval system