KEGG   Brucella canis ATCC 23365: BCAN_A1945Help
Entry
BCAN_A1945        CDS       T00623                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00020  Citrate cycle (TCA cycle)
bcs00190  Oxidative phosphorylation
bcs00650  Butanoate metabolism
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01120  Microbial metabolism in diverse environments
bcs01130  Biosynthesis of antibiotics
bcs01200  Carbon metabolism
Module
bcs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcs_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAN_A1945 (sdhA)
   00650 Butanoate metabolism
    BCAN_A1945 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCAN_A1945 (sdhA)
Enzymes [BR:bcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCAN_A1945 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BCAN_A1945 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABX62935
UniProt: A9M8N7
LinkDB All DBs
Position
I:complement(1834972..1836813)
Genome map
AA seq 613 aa AA seqDB search
MASAVNNAAPAAASKYTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSH
TVAAQGGIAASLKNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVP
FSRTEEGKIYQRPFGGHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEY
FALDLIMTDGVCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGM
VARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLAS
RDVVSRCMTMEIRAGRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEP
IPVLPTVHYNMGGIPTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLI
DLVVFGRAAAIRAGQVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRT
MQEDAAVFRTEESLKQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTT
VVSAEARQESRGAHAREDFPDRNDAEWRKHTLSRLSPDGKVTLDYRPVHLDPLTTEEEGG
ISLAKIAPKKRVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgcagtaaacaatgcggcgcccgccgctgcaagcaagtacacctatgtcgat
cacaagttcgacgtggtggtggtcggagccggcggcgcgggcttgcgcgcaaccctcggc
atggccgaacagggcctcaagacggcttgtatcaccaaggttttcccgacccgctcgcat
acggttgcggcgcagggcggcatcgccgcttcgctcaagaacatggggccggatagctgg
cagtggcatatgtacgacaccgtgaaagggtcggactggctgggcgataccgacgccatg
gaatatctgacccgcgaagcgcctgccgccgtctacgagcttgagcattacggcgtgccg
ttctcgcgtacggaagaaggcaagatctatcagcgcccctttggcggccacatgcagaat
ttcggcgatggtcctccggttcagcgcacctgcgctgctgccgaccgtaccggccatgcc
atcctgcatacgctttacggccagtcgctgaagaacaatgcgcagttcttcattgaatat
ttcgcgctcgacctcatcatgaccgatggcgtgtgcaccggcgtcgtggcgtggaacctc
gatgacggcacgatccatcgcttctccgccaagatggtggttctggcgacgggcggctat
ggccgcgcctatttctcggcaacctctgcccatacctgcaccggcgacggcggcggcatg
gtggcacgcgccggcctgccgttgcaggacatggaattcgtgcagttccacccgaccggc
atttatggcgcgggctgcctcatcaccgaaggcgcgcgcggcgaaggcggctatctggtc
aattccgaaggcgaacgcttcatggagcgttatgccccctcggccaaggaccttgcctcg
cgagacgttgtttcgcgctgcatgacgatggaaattcgtgcgggccgcggcgtcggcaag
aacaaggaccacatctacctgcatctcgaccatctcgaccctgctgttctgcatgaacgc
ctgccgggcatttccgagtcggccaagattttcgcgggcgtggatgtgaccaaggaaccg
atcccggttctgccgaccgttcactacaatatgggcggcattccgaccaactattggggc
gaagtgctgaacccgaccaaggaagacccggaccgcgtgcagccgggcctgatggccgtg
ggcgaagcgggctgcgcttcggtgcatggcgcaaaccgtctcggctccaactcgctgatc
gatctcgtggtgttcggccgcgcggctgcgatccgcgccggtcaggtcatcgaccgcaag
tcgaagatcccggatatcgatatcgctgcctgtgacaagatcatggaacgcttcgaccgc
ctgcgctttgccaacggctccacgccgacggctgtgctgcgtgaaaagatgcagcgcacc
atgcaggaagatgccgccgtgttccgcacggaggaatcgctcaagcagggtgtcgagcgc
atggaaaagctctggcatgaactgccggacatcaaggtcacagatcgctccatgatctgg
aactcggatctcgttgaaacgctggaacttgaaaatctgatggcgaatgcgctgacgacc
gttgtttcggcggaagcccgtcaggaaagccgcggcgcccatgcgcgcgaggatttcccg
gaccgcaacgacgcggaatggcgcaagcacacgctttcccggctttcgcctgacggcaag
gtcacgctcgactatcgtccggttcatctcgatccgctgacgacggaagaggaaggtggc
atcagcctcgccaagattgcgccgaagaagcgcgtttactga

DBGET integrated database retrieval system