KEGG   Brucella canis ATCC 23365: BCAN_A1953Help
Entry
BCAN_A1953        CDS       T00623                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
bcs  Brucella canis ATCC 23365
Brite
KEGG Orthology (KO) [BR:bcs00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BCAN_A1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ABX62943
UniProt: A9M8P5
LinkDB All DBs
Position
I:complement(1842653..1842904)
Genome map
AA seq 83 aa AA seqDB search
MIDMPSSTIVLIFVTFCAAGVVKGVTGMGVTGMGLPTVAMGVLGAFISPLAAASLLIVLS
FATNLWQLWRGRHSVLSCDVYGR
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatatgccgtcatccaccatcgttctgatcttcgtgaccttttgtgcggctggg
gtagtcaagggcgtgaccggcatgggtgtgaccggcatggggttgcccacagtcgccatg
ggggtgctcggggcgtttatctcgcccttggcagcagccagtctgctgatcgtgctttcg
ttcgccaccaatctctggcaactctggcggggtcggcattccgtcctgtcctgcgacgtc
tatggccgatga

DBGET integrated database retrieval system