KEGG   Burkholderia cepacia GG4: GEM_0543Help
Entry
GEM_0543          CDS       T02205                                 

Definition
(GenBank) penicillin-binding protein 6
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00550  Peptidoglycan biosynthesis
bct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GEM_0543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bct01002]
    GEM_0543
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bct01011]
    GEM_0543
Enzymes [BR:bct01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GEM_0543
Peptidases [BR:bct01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   GEM_0543
Peptidoglycan biosynthesis and degradation proteins [BR:bct01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   GEM_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AFQ46994
UniProt: J7J3R4
LinkDB All DBs
Position
1:604794..606107
Genome map
AA seq 437 aa AA seqDB search
MRLSPQGLKSLASSIAFGTAARNVALGVMLPVALASTIVVAEAKPAAKAKAAHAAPAAAE
QFTGAPATFMPGAVPPPGVNAHSWVLVDATSNTVLASGNADERVEPASLTKLMTAYLVFE
ALDKKKISMEQIVTPSAAVRRVGTDESRMFIEADKPVSVHDLVYGMIIQSGNDAAIALAE
LVGGSEGQFVTLMNDEAQRLGMKGTHFADVNGMPDPNHYTTAGDLAKLSAHLVRDFPQYY
SIFSEKEFKYNNIRQGNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRAIPGVDGQRRL
VSVMMGEQKEGERTQDSMKMLNYGYSAFDAVRLFKGGQAMSTPRIYKGKENTVQVGVKGD
QWVTVPRGLGEKVKPQVEVNAPLIAPLAEGQQVGTVKIVADGKTLSEFPVVALQAVPEAG
IFGRIWDSILLMFSKKK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtctccccaaggcctcaagtccctcgcttcctccatcgccttcggcaccgcc
gcgcgcaacgtcgcgctgggcgtgatgctgcctgtcgcgctcgcgtcgacgatcgtcgtc
gcggaagcgaagccggccgccaaggccaaggccgcgcatgccgcgccggccgccgccgag
cagttcaccggcgcgcccgcgaccttcatgccgggcgcggtgccgccgccgggcgtgaac
gcgcactcgtgggtgctcgtcgatgcgacgagcaacacggtgctcgcgtcgggcaacgct
gacgaacgcgtcgagcccgcctcgctgacgaagctgatgacggcctacctggtgttcgag
gcgctcgacaagaagaagatctcgatggagcagatcgtcacgccgagcgcagccgtgcgc
cgcgtcggcaccgacgagtcgcggatgttcatcgaggcggacaagccggtgtcggtacac
gacctcgtgtacgggatgatcatccagtcgggcaacgacgccgcgatcgcgctggccgaa
ctggtcggcggcagcgaagggcagttcgtcacgctgatgaacgacgaggcgcagcgcctc
ggcatgaagggcacgcacttcgccgacgtgaacggcatgcccgacccgaaccactacacg
acggccggcgacctcgcgaagctgtccgcacacctggtccgcgattttccgcagtactac
agcatcttctcggagaaggaattcaagtacaacaacatccgccagggcaaccgcaaccgg
ctgctttggctggatccgacggtcgacggcctgaagacgggccatacgcaggcggcgggc
tactgcctgatcgcgtcggccaagcgcgcgatcccgggtgtcgatggccagcgtcgcctc
gtgtcggtgatgatgggcgagcagaaggaaggcgagcgcacgcaggacagcatgaagatg
ctgaactacggctatagcgcgttcgacgcggtgcgcctgttcaagggcggccaggcgatg
tcgacgccgcgcatctacaagggcaaggaaaacaccgtgcaggtcggcgtgaagggcgac
cagtgggtgaccgtgccgcgcggcctcggcgagaaggtcaagccgcaagtcgaagtcaac
gcgccgctgatcgcaccgctcgcggaaggccagcaggtcggcaccgtgaagatcgtcgcc
gacggcaagacgctgtcggagttcccggtcgtcgccctgcaggccgtgcctgaagcgggt
atcttcgggcgtatctgggactcgatcctgctgatgttcagcaagaagaagtaa

DBGET integrated database retrieval system