KEGG   Burkholderia cepacia GG4: GEM_0665Help
Entry
GEM_0665          CDS       T02205                                 

Definition
(GenBank) uracil-DNA glycosylase superfamily protein
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bct00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GEM_0665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bct03400]
    GEM_0665
Enzymes [BR:bct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     GEM_0665
DNA repair and recombination proteins [BR:bct03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GEM_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AFQ47114
UniProt: J7J432
LinkDB All DBs
Position
1:736235..736786
Genome map
AA seq 183 aa AA seqDB search
MADALPDIIAPQLDVLFCGINPGLTAAATGHHFAGRNNRFWRMLHLAGFTPDEIAPQDDR
TILQYGCGLTAVVPRPTASADQLSHAEFIAAAAVFEQKVARHAPRFVAFLGKAAYAALSG
QREIAWGLQPARMQRAAVWILPNPSGRNRAFGSDELVDAYRQLRIAARAVAGRHRHEAPD
DAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacgcactccccgacatcatcgccccgcagctcgacgtgctgttctgcggaatc
aaccccggcctgaccgcggccgcgaccggccatcacttcgccggaaggaacaaccgcttc
tggcgcatgctgcatctcgcgggctttacgccggacgaaatcgcgccgcaggacgaccgg
acgattctgcagtacggatgcgggctgaccgcggtcgtgccgcgaccgaccgcaagtgcc
gatcagctgtcgcacgcggaattcatcgcggccgcggccgtcttcgagcagaaggtcgcg
cgtcatgcgccacgcttcgtcgcgtttctcggcaaggccgcttacgccgcgctctccggg
caacgcgagatcgcgtgggggctgcaaccggcgcgcatgcagcgcgcggccgtctggatc
ctgccgaacccgagcggaagaaaccgtgcattcggcagcgacgaactggtcgatgcgtac
cgtcagcttcgtatcgcggcgcgcgccgtggcgggccgccaccggcacgaggcgccggat
gacgcgcaataa

DBGET integrated database retrieval system