KEGG   Burkholderia cepacia GG4: GEM_0682
Entry
GEM_0682          CDS       T02205                                 

Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00998  Biosynthesis of various secondary metabolites - part 2
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GEM_0682
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    GEM_0682
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: AFQ47131
UniProt: J7J868
LinkDB
Position
1:753102..753386
AA seq 94 aa
MGRLPASMMNALEQELATLIIGELNLEDVPLETVTAGTPLYGEGFGLDSIDILEIALLIS
KKYGFELRSDNPDNQKIFATLGALAAYVAAHRTK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgggccgcctgcccgcaagcatgatgaacgcactggaacaagagctcgccacgctgatc
atcggcgaattgaatctcgaagacgtcccgctcgaaacggtgacggccgggaccccgctg
tacggcgagggcttcgggctcgactccatcgacatcctggaaatcgcgctgctgatctcg
aagaagtacggcttcgagctgcgctcggacaatccggacaaccagaagatcttcgcgacg
ctcggcgcgcttgccgcgtacgtcgccgcgcatcgcacgaagtga

KEGG   Burkholderia cepacia GG4: GEM_2395
Entry
GEM_2395          CDS       T02205                                 

Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00998  Biosynthesis of various secondary metabolites - part 2
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GEM_2395
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    GEM_2395
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: AFQ48804
UniProt: J7J8Y6
LinkDB
Position
1:complement(2632104..2632343)
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKTEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggataacatcgaacaacgtgtcaagaagatcgtcgctgagcaactgggcgtcgcagaa
gccgagatcaagaccgaagcttcgttcgtgaacgatctgggcgcggactcgctcgacacg
gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca
gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system