KEGG   Burkholderia cepacia GG4: GEM_0887Help
Entry
GEM_0887          CDS       T02205                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bct  Burkholderia cepacia GG4
Brite
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GEM_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFQ47335
UniProt: J7J012
LinkDB All DBs
Position
1:978319..978897
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPSGALGDAINAKWGSYDAFKEAFSKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctcccgtacgctgaagacgcactcgcgccgaccatctcg
aaagagacgatcgagtaccactacggcaagcatcaccaggcttatgtgacgaacctgaac
aatctgatcccgggcacggaattcgaaaacctgtcgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcaaatctggaaccacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgcaccgtcgggcgcgctgggcgacgcgatcaacgcgaag
tggggttcgtacgacgcgttcaaggaagcgttctcgaaggccgcggtcggcacgttcggt
tcgggctgggcatggctcgtgaagaaggccgacggttcgctcgacatcgtgtcgacgagc
aacgccgctacgccgctgacgacggccgacaaggcactgctgacgatcgacgtgtgggaa
cacgcgtactacatcgactaccgcaacgcacgtccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgcagcgaagaacttcgcgtaa

DBGET integrated database retrieval system