KEGG   Burkholderia cepacia GG4: GEM_0906Help
Entry
GEM_0906          CDS       T02205                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00020  Citrate cycle (TCA cycle)
bct00480  Glutathione metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
bct01210  2-Oxocarboxylic acid metabolism
bct01230  Biosynthesis of amino acids
Module
bct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bct_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_0906
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GEM_0906
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GEM_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFQ47354
UniProt: J7J4U4
LinkDB All DBs
Position
1:998783..1000039
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAQAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgacgcggcggtcgcgcaggcctacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgacgaaggtgtac
ggtccggacgtgtggctcccggacgaaacgctgcaggtgctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtgtgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgcgagccgcaaaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggccgcgggctccgagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtcatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgcgacgttgaacctgaacggcgactacatctccgacgcactggccgcgcaggtcggc
ggcatcgggatcgcgccgggtgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtatcgtgctccggtttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system