KEGG   Burkholderia cepacia GG4: GEM_1658Help
Entry
GEM_1658          CDS       T02205                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
bct  Burkholderia cepacia GG4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: AFQ48083
UniProt: J7J9Y6
LinkDB All DBs
Position
1:1799501..1800937
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGVASDAQDAIRAARAAFDAWAA
TPAATRAGYLRKIVERLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAES
FEFEATVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPPGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVNACYLNAGQTCSAHTRMLVPEARYDEAREIAK
AAAEAYVAGDPREEATRLGALASAVQQQRVQAYIQRGIDDGAELVTGGTGLPEGLAKGFF
VKPTVFGRVDPKSAIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGTWNGAAPFGGYKQSGHGRENGVYGLEEYLEYKSMQLKPSNPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctacatcgacggcgcatggcgcaaaccggccggaacgggc
acgatcgacgtgatcgactcgggtaccgaggccgtgatcggccggattccggagggcgtg
gcgtccgacgcgcaggacgcgatccgcgcggcgcgcgccgcgttcgacgcctgggccgcg
acgccggcagcgacgcgcgcgggttacctgcgcaagatcgtcgagcgcctgcaggcgcgc
agcgaggaactcgcgcagtcgatcaccggcgaggtcgggatgccgatcaagctgtcacgc
gcgatccaggttggcggcccgatctacaactggaaggcatacgcgaagctcgccgaatcg
ttcgaattcgaggcgacggtcggcaactcgctggtggtgcgcgagccggtcggcgtcgtc
gctgcgatcacgccgtggaactatccgctcaaccaggtcacgctgaaggtcgcgccggca
ctcgcggccggctgcacggtcgtcctgaagccgtccgaggtcgcaccgctcaacgcgttc
atgctcgccgaggcgatccacgaagcgggcctgccgccgggcgtgttcaacctcgtgtgc
ggctacggcccggtcgtcggcgaggtgctggccaccgatccggacgtcgacatggtgtcg
tttacgggctcgacgcgcgccggcaagcgggtggccgaactcgcggccgcgggcgtcaag
cgcgtcgcgctcgaactgggcggcaagtcggcgtcggtgatcctcgacgatgccgatttc
gcggcggcggtgaagggcacggtcaacgcgtgctacctgaacgcgggccagacctgttcg
gcgcacacgcggatgctggtgccggaggcacgctacgacgaggcgcgcgagattgcgaag
gcggccgccgaagcgtacgtcgcgggcgatccgcgcgaggaggcgacgcgcctgggcgca
ctcgcatcggccgtgcagcagcagcgcgtgcaggcgtacatccagcgcggcatcgacgat
ggcgcggagctcgtgacgggcggcacgggcctgccggaagggctcgcgaagggtttcttc
gtgaagccgaccgtgttcggtcgcgtcgatccgaaatcggcgatcgcgcaggaggaaatc
ttcgggccggtgctgtcgatcatcacgtatcgcgacgaagacgaggccgtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtctgggcgggcagcgacgaacgcgcgatg
cgcgtggcgcgccgcatccgcacgggccaggtcgacatcaacggcggcacgtggaacggc
gccgcaccgttcggcggctacaagcagtcgggccacggccgcgagaacggcgtgtacggg
ctcgaggagtatctcgagtacaagtcgatgcagctcaagccgtcgaatccggcctga

DBGET integrated database retrieval system