KEGG   Burkholderia cepacia GG4: GEM_1782Help
Entry
GEM_1782          CDS       T02205                                 

Definition
(GenBank) taurine catabolism dioxygenase TauD/TfdA
Organism
bct  Burkholderia cepacia GG4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauD
Motif
Other DBs
NCBI-ProteinID: AFQ48207
UniProt: J7J1Z2
LinkDB All DBs
Position
1:complement(1940407..1941426)
Genome map
AA seq 339 aa AA seqDB search
MTLLSLPTLDDLRIEPGLPTVVSPRSADGMSIDALAPLAHAIAADALERAGGVLFTGFHV
PSIDAFQQFAASFGDPLIGYEYASTPRSQVEGAVYTSTEYPPHRVIPLHNEQSYTREWPL
RIWFHCALAAPKGGATPIADSRAVYRALDPALVARFERRELLYVRNFGQGLDLPWQQSFG
TDEPAEVDRMCAARGIECAWRTDDDGELLLRTRERCQAVARHPRTGDRVWFNQANLFHLS
ALDDDMQDALVDAVGLENVPRNVYYGDGAPLEADALAEIRGVLDRQRIVFPWQTGDVLML
DNMLTAHARDPFEGPRKVVVAMAQSYTVTRATERRTDDA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgctttcgttgccgacgctcgacgacctgcgtatcgagccggggctgcccacc
gtcgtatcgccgcgcagcgccgacggcatgtcgatcgacgcgctcgcgccgcttgcgcat
gcgatcgcggccgatgcgctcgaacgggcgggcggtgtgctgttcacgggctttcacgtg
ccgtcgatcgacgcgttccagcagttcgcggcgtcgttcggcgatccgctgatcggctat
gaatacgcatcgacgccgcgcagccaggtcgaaggcgccgtctatacgtcgaccgaatat
ccgccgcaccgcgtgattccgctgcataacgaacagtcgtatacgcgcgaatggccgctg
cggatctggttccattgcgcgctcgcggcgccgaagggcggggcgacgccgatcgcggac
agccgcgccgtctatcgcgcgctcgatccggcgctggtcgcgcgcttcgagcggcgcgag
ctgctgtacgtgcgcaatttcggccaagggctcgacctgccgtggcagcagtcgttcggc
accgacgagccggccgaggtcgaccggatgtgcgcggcgcgcgggatcgaatgcgcatgg
cgcaccgacgacgacggcgaactgctgttgcgcacgcgcgaacgctgccaggccgtcgca
cggcatcctcgcaccggcgaccgcgtgtggttcaaccaggcgaacctgtttcacctgtcc
gcgctcgacgacgacatgcaggacgcgctcgtcgacgcggtcgggctcgagaacgtgccg
cgcaacgtgtactacggcgacggcgcaccgctcgaggccgacgcgctcgcggagattcgc
ggcgtgctcgaccgccagcgcatcgtgttcccgtggcagacgggcgacgtgctgatgctc
gacaacatgctgaccgcgcatgcgcgcgacccgttcgaggggccgcgcaaggtggtcgtc
gcgatggcgcagagttacacggtcacgcgcgcgaccgaacggaggaccgatgacgcgtag

DBGET integrated database retrieval system