KEGG   Burkholderia cepacia GG4: GEM_3569Help
Entry
GEM_3569          CDS       T02205                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00270  Cysteine and methionine metabolism
bct00330  Arginine and proline metabolism
bct00410  beta-Alanine metabolism
bct00480  Glutathione metabolism
bct01100  Metabolic pathways
Module
bct_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GEM_3569
   00330 Arginine and proline metabolism
    GEM_3569
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEM_3569
   00480 Glutathione metabolism
    GEM_3569
Enzymes [BR:bct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     GEM_3569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_25 DUF3681 Methyltransf_23 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFQ49960
UniProt: J7J7I6
LinkDB All DBs
Position
2:complement(429900..431414)
Genome map
AA seq 504 aa AA seqDB search
MLHKRALVLSILVLASCGLGYELISSALSSYLLGDSILQFSSVIGCYLFAMGIGSWLAKF
VEDDDVLDRFVDIELLVGLLGGVSAALLFVVFAWLAAPFRAALYALVLALGLLIGMEIPL
VMRAFQQRRQAFRHTVSEVLTFDYLGSLAVSLIFPLVLAPRLGLLRTSFLFGLLNAFVAL
WTTHLFRDEIRNVRGKLMRASLVIGLLVAGFALSDRITHWAEHGVYGDETIYSETTPYQR
IVLTQWHDDMRLYLNGNLQFSSRDEHRYHEALIHPTIDALPWAKRVLVLGGGDGLAVREL
LKHRNLEQITLVDLDPAMTKLFSTSAPLVKLNQGALRDPRVRVINDDAVRWLESNADVYD
AIVVDFPDPTNFGLGRLYSVPVFRLLARHLSENGYAVIQSTSPYFAPHAYWTIIATLHEA
GLNTWPYHCYVPSFGDWGFVIAGKRRDFTVPTHYSVPTRWLDAQTAAEMFHFPADMPALP
MSPNELNDQPLVRRFDDDWKHVLR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctgcataagcgcgcgctcgtcctgtcgatcctcgtgctcgcgtcgtgcgggctcggc
tacgaactgatcagcagcgcgctgtcgagctacctgctcggcgattcgatcctgcaattc
tcgtcggtgatcggctgctacctgttcgcgatggggatcggctcgtggctcgcgaagttc
gtcgaggacgacgacgtgctcgaccgcttcgtcgacatcgagctgctcgtcggcctgctc
ggcggcgtgtcggccgcgctgctgttcgtggtgttcgcatggctggccgcgccgttccgc
gcagcgctctacgcgctcgtgctcgcgctcggcctgttgatcgggatggagatcccgctg
gtgatgcgcgcgttccagcagcgccgccaggcgttccgccataccgtcagcgaggtgctg
accttcgactatctcggctcgctcgccgtgtcgctgatcttcccgctcgtgctcgcgccg
cgtctcggcctgttgcgcacgagcttcctgttcggcctgctgaacgcgttcgtcgcgctg
tggaccacgcacctgttccgcgacgagatccgcaacgtgcgcggcaagctgatgcgcgcg
tcgctcgtgatcgggctgctcgtcgccggcttcgcgctgtcggaccgcatcacgcactgg
gccgaacacggcgtgtacggcgacgagacgatctattcggaaacgacgccgtaccagcgc
atcgtgctcacgcagtggcacgacgacatgcggctgtacctgaacggcaacctgcagttc
tcgtcgcgcgacgagcaccgctatcacgaggcactgatccatccgacgatcgacgcgctg
ccgtgggcgaagcgcgtgctggtgctcggcggcggcgacggcctcgcggtgcgcgaactg
ctcaagcaccgcaacctcgaacagatcacgctcgtcgacctcgatccggcgatgacgaag
ctgttctcgacgtccgcgccgctcgtgaagctgaaccagggcgcactgagggacccgcgc
gtgcgcgtgatcaacgacgacgcggtgcgctggctcgaatcgaatgccgacgtgtacgac
gcgatcgtcgtcgacttccccgatccgaccaacttcgggctcggccggctctattcggtg
ccggtgttccgcctgctcgcgcgccacctgtcggagaacggctatgcggtgatccagtcg
acgtcgccgtatttcgcgccgcacgcgtactggacgatcatcgcgacgctgcacgaagcc
gggctcaacacctggccgtaccactgctacgtgccgtcgttcggcgactgggggttcgtg
atcgccggcaagcgccgcgacttcaccgtgccgacgcactactcggtaccgacgcgctgg
ctcgacgcgcagacggccgccgagatgttccacttcccggccgacatgccggcgctgccg
atgtcgccgaacgaactcaacgaccagccgctcgtgcgccgcttcgacgacgactggaag
cacgtgctgcgctga

DBGET integrated database retrieval system