KEGG   Burkholderia cepacia GG4: GEM_4496
Entry
GEM_4496          CDS       T02205                                 

Definition
(GenBank) thiamine pyrophosphate binding domain-containing protein
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00440  Phosphonate and phosphinate metabolism
bct00998  Biosynthesis of various secondary metabolites - part 2
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    GEM_4496
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    GEM_4496
Enzymes [BR:bct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     GEM_4496
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: AFQ50886
UniProt: J7JIL7
LinkDB
Position
2:1452997..1454184
AA seq 395 aa
MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDPTLHYLSAANEGDAVALIAGATL
GGKRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVSDEPQHALMGPITPAM
LDTMEIPWETFPTDPEQVGPALDRAIAHMDATGRPYALVMQKGSVAPYELKANPAATPRA
HVAAQSAARAEAPAAWPTRHDALQRVIAHTPVDSTVVLASTGFCGRELYALDDRPNQLYM
VGSMGCVTPLALGLALARPDLHVVAVDGDGAALMRMGVFATLGTYGPANLTHVLLDNGAH
ESTGGQATVSQHVSFAGVAAACGYASAVEGDTLDVLDAALDAPQPADGTRFVRLAIRTGV
PDGLPRPTVTPVEVKTRLMRHIGAAQAQAHAEGAL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgatcgaagcggcccagttcgtcgaggccgcacgcgaacgcggcttcgactggtacgcc
ggcgtgccctgctcgtacctgacgccgttcatcaactacgtgctgcaggacccgacgctg
cactacctgtcggccgccaacgaaggcgacgcggtcgcgctgatcgcgggcgcgacgctc
ggcggcaagcgcgggatcgcgatgatgcagaactccgggctcggtaacgcggtgagcccg
ctcacgtcgctgacctggacgttccggctgccgcagctgctgatcgtcacgtggcgcggc
cagccgggcgtatccgacgagccgcagcacgcactgatggggccgatcacgccggcgatg
ctcgacacgatggagatcccgtgggagacgttcccgaccgaccccgaacaggtcggcccg
gcgctcgaccgcgcgatcgcgcacatggacgcaacgggccgcccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgccgtatgagctgaaggcgaacccggcggcgacgccgcgcgcg
catgtcgccgcgcagtcggcggcgcgtgccgaagcgcccgccgcgtggccgacccgccac
gacgcgctgcagcgcgtgatcgcgcacacaccggtcgactcgaccgtcgtgctcgcgtcc
accggcttctgcggccgcgaactctatgcgctcgacgaccgcccgaaccagctgtacatg
gtcggctcgatgggctgcgtgacgccgctcgcgctcggcctcgcgctcgcgcgccccgac
ctgcacgtggtggccgtcgacggcgacggcgccgcgctgatgcgaatgggcgtgttcgcg
acgctcggcacctacggcccggccaacctcacgcacgtgctgctcgacaacggcgcgcac
gaatcgacgggcggccaggcgaccgtgtcgcagcatgtgtcgttcgcgggcgtcgccgcc
gcgtgcggctatgcgtcggccgtcgaaggcgacacgctcgacgtgctcgatgcggcgctc
gacgcgccgcaaccggccgacggcacgcggttcgtgcggctcgcgatccgtacgggcgtg
cccgacggcctgccccgcccgaccgtcacgccggtcgaggtcaagactcgcctgatgcgg
catatcggcgccgcgcaggcacaagcccacgccgaaggagcgctttga

DBGET integrated database retrieval system