KEGG   Burkholderia cepacia GG4: GEM_5410Help
Entry
GEM_5410          CDS       T02205                                 

Definition
(GenBank) methane/phenol/toluene hydroxylase
  KO
K16242  phenol/toluene 2-monooxygenase (NADH) P3/A3 [EC:1.14.13.244 1.14.13.243]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00361  Chlorocyclohexane and chlorobenzene degradation
bct00362  Benzoate degradation
bct00623  Toluene degradation
bct01100  Metabolic pathways
bct01120  Microbial metabolism in diverse environments
bct01220  Degradation of aromatic compounds
Module
bct_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GEM_5410
   00361 Chlorocyclohexane and chlorobenzene degradation
    GEM_5410
   00623 Toluene degradation
    GEM_5410
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     GEM_5410
    1.14.13.244  phenol 2-monooxygenase (NADH)
     GEM_5410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_Hydrox YHS
Motif
Other DBs
NCBI-ProteinID: AFQ51794
UniProt: J7JH82
LinkDB All DBs
Position
2:complement(2463392..2464942)
Genome map
AA seq 516 aa AA seqDB search
MDTPTLKKKLGLKDRYAAMTRGLGWETTYQPMDKVFPYDRYEGIKIHDWDKWVDPFRLTM
DAYWKYQGEKEKKLYAVIDAFTQNNAFLGVTDARYINALKLFIQGVTPLEYLAHRGFAHV
GRHFTGEGARIACQMQSIDELRHYQTETHAMSTYNKFFNGFHHSNHWFDRVWYLSVPKSF
FEDAYSSGPFEFLTAVSFSFEYVLTNLLFVPFMSGAAYNGDMSTVTFGFSAQSDESRHMT
LGIECIKFLLEQDPDNVPIVQRWIDKWFWRGYRLLTLVAMMMDYMQPKRVMSWRESWEMY
AEQNGGALFKDLARYGIREPKGWQDACEGKDHISHQAWSTFYGFNAASAFHTWVPTEDEL
AWLSAKYPDSFDRHYRPRFDYWGEQATAGNRFYMKTLPMLCQTCQIPMLFTEPGNPTKIG
ARESNYLGNRFHFCSDHCKEIFDHEPQKYVQAWLPVHQIHQGNCFPPDADPSAEGFDPLA
AVLDYYAVQMGRDNLDFDGSEDQKNFAAWRGQATSN
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccaacgctcaagaaaaagctcggcctgaaggatcgctacgcggcaatgacg
cgcggcctcggctgggagacgacctaccagccgatggacaaggtcttcccgtacgaccgc
tacgagggcatcaagatccacgactgggacaagtgggtcgacccgtttcgcctgacgatg
gatgcgtactggaaataccagggcgagaaggaaaagaagctgtacgcggtgatcgacgcg
ttcacgcagaacaacgcattcctcggcgtgaccgacgctcgctacatcaacgcgctgaag
ctgttcatccagggcgtgacgccgctcgaatatctcgcgcatcgcggcttcgcgcacgtc
ggccggcacttcaccggcgagggcgcgcgcatcgcgtgccagatgcagtcgatcgacgag
ctgcggcactaccagaccgaaacgcacgcgatgtcgacgtacaacaagttcttcaacggg
ttccatcactcgaaccactggttcgaccgcgtctggtacctgtcggtgccgaagtcgttc
ttcgaggatgcctattcgtcggggccgttcgagttcctgaccgcggtcagcttctcgttc
gaatacgtgctgacgaacctgctgttcgtgccgttcatgtcgggcgccgcctacaacggc
gacatgtcgaccgtcacgttcgggttctccgcgcagtcggacgaatcgcgccacatgacg
ctcggcatcgagtgcatcaagttcctgctcgaacaggatccggacaacgtgccgatcgtg
cagcgctggatcgacaagtggttctggcgcggctaccggctgctcacgctggtcgcgatg
atgatggactacatgcagccgaagcgcgtgatgagctggcgcgaatcgtgggagatgtac
gcggagcagaacggcggcgcgctgttcaaggacctcgcgcgctacggcattcgcgagccg
aagggctggcaggacgcgtgcgaaggcaaggaccacatcagccaccaggcctggtcgacg
ttctacggcttcaacgcggcttcggcattccacacgtgggtgccgaccgaagacgagctg
gcgtggctgtccgcgaagtatcccgattcgttcgaccgccactaccgtccgcgcttcgac
tactggggcgagcaggcgacggccggcaaccgcttctacatgaagacgctgccgatgctg
tgccagacctgtcagatcccgatgctgttcaccgagcccggcaacccgacgaagatcggc
gcgcgcgagtcgaactacctcggcaacaggttccatttctgcagcgatcactgcaaggaa
atcttcgatcacgagccgcagaaatacgtgcaggcgtggctgccggtacaccagatccat
cagggcaactgcttcccgccggatgcggacccgagcgcggaaggcttcgatccgctcgcc
gcggtgctcgactactacgcggtgcagatgggccgcgacaacctcgatttcgacggctcc
gaagaccagaagaacttcgcggcatggcgaggccaggccacgagcaactga

DBGET integrated database retrieval system