KEGG   Burkholderia cepacia GG4: GEM_5614
Entry
GEM_5614          CDS       T02205                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K18383  feruloyl-CoA hydratase/lyase [EC:4.1.2.61]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00998  Biosynthesis of various secondary metabolites - part 2
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    GEM_5614
Enzymes [BR:bct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.61  feruloyl-CoA hydratase/lyase
     GEM_5614
SSDB
Motif
Pfam: ECH_1 ECH_2 DEP DUF3389
Other DBs
NCBI-ProteinID: AFQ51998
UniProt: J7JKK1
LinkDB
Position
2:2680076..2680906
AA seq 276 aa
MSKYDNRWQTVEVNVEAGIAWVTLNRPDKRNAMSPTLNREMLQVLDAVEFDDEAKVLVLT
GAGAAWTAGMDLKEYFREIDGGSDALQEKVRRDASEWQWRRLRMYNKPTIAMVNGWCFGG
GFSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGHRRALHYIMTGDTFTGA
EAADMGLVNSSVPLAGLRDATIALAARLMDKNPVVLRAAKHGFKRSRELTWEQCEDYLYA
KLDQAQLRDPERGREQGLKQFLDDKTIKPGLQAYKR
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagcaagtacgacaaccgctggcagaccgttgaagtgaacgtggaggccggtatcgcg
tgggtgacgctgaaccgcccggacaagcgcaatgcgatgagcccgacgctgaaccgggag
atgctgcaggtactcgacgcggtcgagttcgacgacgaagcaaaggtgctggtgctgacc
ggcgcgggcgccgcgtggacggccggcatggatctgaaggaatatttccgcgagatcgac
ggcggctccgacgcgctgcaggaaaaggtgcggcgcgacgcatcggaatggcagtggcgc
cgcctgcggatgtacaacaagccgaccatcgcaatggtgaacggctggtgcttcggcggc
ggattctcgccgctcgtcgcgtgcgacctcgcgatcgcggcggacgaagccgtgttcggg
ctgtcggagatcaactggggcatcccgcccggcaacctcgtcagcaaggcgatggcggat
acggtcgggcatcgtcgcgcgctgcactacatcatgaccggcgacacgttcaccggcgcg
gaagcggcggacatgggcctcgtgaacagcagcgtgccgctggccggcctgcgcgacgcg
acgatcgcgctcgccgcgcggctgatggacaagaacccggtcgtgctgcgcgccgcgaaa
cacggcttcaagcgttcgcgcgaactcacgtgggaacagtgcgaggattacctgtatgcg
aagctcgaccaggcgcagctgcgcgatccggagcgcggccgcgagcaggggctgaagcag
ttcctcgacgacaagacgatcaagccgggcctgcaggcatacaagcgctga

DBGET integrated database retrieval system